Recombinant Human Transcription activator BRG1(SMARCA4),partial

Code CSB-YP021801HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names SMARCA4
Uniprot No. P51532
Research Area Cancer
Alternative Names ATP dependent helicase SMARCA4; ATP-dependent helicase SMARCA4; BAF 190; BAF190; BAF190A; Brahma protein like 1; BRG1; BRG1 associated factor 190A; BRG1 protein; BRG1-associated factor 190A; BRM/SWI2 related gene 1; Global transcription activator homologous sequence; global transcription activator snf2l4; Homeotic gene regulator; hSNF2b; Mitotic growth and transcription activator; MRD16; Nuclear protein GRB1; Protein brahma homolog 1; Protein BRG-1; Protein BRG1; RTPS2; SMARC A4; SMARCA4; SMCA4_HUMAN; SNF2; SNF2 beta; SNF2 like 4; SNF2-beta; SNF2B; SNF2L4; SNF2LB; Sucrose nonfermenting like 4; SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A member 4; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4; SWI2; Transcription activator BRG1
Species Homo sapiens (Human)
Source Yeast
Expression Region 700-1246aa
Target Protein Sequence EVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 64.8kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

I am interested in the SMARCA2 Recombinant Protein SMARCA4 Recombinant Protein (CSB-YP021801HU), but have a few questions first:
1.For product, can these tags be cleaved?
2.The MW of SMARCA4 is also ~180 kDa. Why is this protein (CSB-YP021801HU) only 65 kDa?
3.Could you also provide the lead time + pricing of both proteins using mammalian as an expression system with different tag options?

A:
Very nice to receive your inquiry. CSB-YP021801HU
1) This is a developed protein. The product details are confirmed as below.
Code: CSB-YP021801HU
Name: Recombinant Human Transcription activator BRG1(SMARCA4),partial
Expression Region: 700-1246aa; Partial
Tag Info: N-terminal 6xHis-tagged
Expression Sequence:

EVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF


Product Type: Developed Recombinant Protein
2) The MW of the N-terminal 6xHis-tag is 2.0 kDa. The tag sequence is as below: EAEAYVHHHHHHEFRT
3) This protein was prepared without insertion of restriction sites and was unable to remove the tag.
4) The full-length protein is 1590aa and the MW is ~180 kDa. The above protein we provide is a fragment with 700-1216aa expression region and the MW is ~62.8 kDa. The tag sequence is as below.

EVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF


So the MW of the fusion protein is 64.8 kDa (2+62.8=64.8).
5) The tags successfully expressed for the MP expression system include N-terminal 10xHis-tagged and C-terminal Myc-tagged, N-terminal 6xHis-tagged, N-terminal 10xHis-tagged, N-terminal Flag-Myc-tagged,
C-terminal FC-tagged, etc.
CSB-MP021801HU >>Mammalian cell
Expression Region: 700-1246aa; Partial
Expression Sequence:

EVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF


Here we provide another expression region for your reference.
CSB-MP021801HU1 >>Mammalian cell
Expression Region: 808-1092aa; Partial
Tag Type: The tag type will be determined during the production process.
Expression Region:

IIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKL

 Customer Reviews

Target Data

Function Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. At the same time, there is increased recruitment of CREBBP to the promoter by a CREST-dependent mechanism, which leads to transcriptional activation. The CREST-BRG1 complex also binds to the NR2B promoter, and activity-dependent induction of NR2B expression involves a release of HDAC1 and recruitment of CREBBP. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. SMARCA4/BAF190A may promote neural stem cell self-renewal/proliferation by enhancing Notch-dependent proliferative signals, while concurrently making the neural stem cell insensitive to SHH-dependent differentiating cues (By similarity). Acts as a corepressor of ZEB1 to regulate E-cadherin transcription and is required for induction of epithelial-mesenchymal transition (EMT) by ZEB1.
Gene References into Functions
  1. BRG1, the essential ATPase subunit of the SWI/SNF chromatin-remodelling complex, is required for expression of Wilms' tumour 1 (Wt1), fetal epicardium-derived cell activation and subsequent differentiation into coronary smooth muscle, and restoration of Wt1 activity upon myocardial infarction. PMID: 28737171
  2. High expression of SMARCA4 is associated with aggressive tumors. PMID: 29391527
  3. This study showed that AURKA inhibitors may provide a therapeutic strategy for biomarker-driven clinical studies to treat the NSCLCs harbouring SMARCA4/BRG1-inactivating mutations. PMID: 28102363
  4. describe the approaches and methods used to identify SMARCA4 mutations, which drive development of the rare ovarian cancer, small cell carcinoma of the ovary, hypercalcemic type (SCCOHT), and point to the broader relevance of this paradigm for future research in rare cancers. PMID: 29423809
  5. Depletion of Brg1 improves the integrity of airway epithelium in asthma by regulating E-cadherin expression in lung epithelial cells. Knockdown of Brg1 increased the cell proliferation and migration by human bronchial epithelial 16HBE cells. PMID: 28801844
  6. High BRG1 expression is associated with leukemia and lymphoma. PMID: 28251496
  7. HDAC9, in cooperation with BRG1 and MALAT1, mediates a critical epigenetic pathway responsible for vascular smooth muscle cells dysfunction. PMID: 29520069
  8. SMARCA4-deficient thoracic sarcomas constitute a unique, highly lethal entity that requires full recognition and differentiation from other epithelioid malignancies involving the thoracic region. PMID: 28256572
  9. The outcome following a diagnosis of any of these tumors is often poor, and the value of surveillance is unknown. International efforts to determine surveillance protocols are underway, and preliminary recommendations are made for carriers of SMARCB1 and SMARCA4 mutations. PMID: 28620006
  10. Study identified DNA methylation (DNAm) site, cg07786668 in ZFHX3 that is independently and significantly associated with myocardial infarction (MI) along with cg17218495 in SMARCA4. These results suggest that the development of MI might be influenced by changes in DNAm at these sites via a pathway that differs from that affected by cardiovascular disease-associated SNPs in these genes. PMID: 28515798
  11. Authors demonstrate that BRG1 upregulates de novo lipogenesis and that this is crucial for cancer cell proliferation. Knockdown of BRG1 attenuates lipid synthesis by impairing the transcription of enzymes catalyzing fatty acid and lipid synthesis. PMID: 27223259
  12. SMARCA4 SNPs are associated with coronary heart disease development in Chinese Han population. PMID: 28055962
  13. BRG1 may contribute to colon cancer progression through upregulating WNT3A expression. PMID: 27852072
  14. We report two new familial cases of SCCOHT. Affected members in both families and the associated tumours were found to carry SMARCA4 germline and somatic mutations PMID: 27866340
  15. Loss of BRG1 is associated with the loss of E-cadherin and up-regulation of Vimentin in primary tumors, which explains why BRG1 loss is associated with a poor prognosis in multiple tumor types. PMID: 27486753
  16. Low expression of SMARCA4/BRG1 is significantly associated with worse prognosis. PMID: 26671993
  17. Taken together, these findings provide a dynamic view of SMARCA4-dependent changes in higher-order chromatin organization and gene expression, identifying SMARCA4 as a novel component of chromatin organization. PMID: 27435934
  18. Of the 34 undifferentiated endometrial carcinomas examined, 17 (50%) exhibited SWI/SNF complex inactivation, with 11 tumors showing complete loss of both ARID1A and ARID1B, 5 showing complete loss of BRG1 and 1 showing complete loss of INI1. Ten of the remaining 17 undifferentiated carcinomas showed the following alterations: 5 tumors (15%) showed loss of ARID1A only with intact ARID1B, BRG1, and INI1 expression. PMID: 28863077
  19. Data suggest that the BRG1/STAT3/VEGFC in tumor-associated lymphangiogenesis might lead to the discovery of novel therapeutic targets in the treatment of cancers with BRG1 loss of function. PMID: 27145366
  20. Results suggest that targeting the enzymatic activity of BRG1 would be an effective adjuvant therapy for breast cancer. PMID: 27029062
  21. The vast majority of SCCOHT demonstrate genomic SMARCA4 loss with only rare co-occurring alterations. Data support a role for CGP in the diagnosis and management of SCCOHT and of other lesions with overlapping histological and clinical features, since identifying the former by genomic profile suggests benefit from an appropriate regimen and treatment decisions. PMID: 29102090
  22. BRG1 can promote VEGF-A expression and angiogenesis in colorectal cancer and BRG1 may be a novel drug target for the treatment of colorectal cancer. PMID: 28899659
  23. The BRG1/SIRT1/p53 signal axis is a novel mechanism of cell senescence in CRC. PMID: 28182012
  24. BRG1 and SMARCAL1, members of the ATP-dependent chromatin remodelling family, are shown to co-regulate the transcription of DROSHA, DGCR8, and DICER in response to double-strand DNA breaks. PMID: 28716689
  25. BRG1 was significantly increased in hepatocellular carcinoma. Overexpression of BRG1 increases cell growth and invasiveness in HCC. PMID: 28700662
  26. Case Report: SMARCA4 nonsense/frameshift mutations responsible for concomitant Coffin-Siris syndrome, microphthalmia and small-cell carcinoma of the ovary hypercalcaemic type. PMID: 28608987
  27. i-motif structures in long cytosine-rich sequences found upstream of the promoter region of the SMARCA4 gene PMID: 28619677
  28. Brg1 coordinates a genetic and epigenetic network that regulates the transcriptional program underlying the Shh-type medulloblastoma development. PMID: 27065321
  29. whole-genome transcriptome analysis revealed that BRG1 controls the expression of key elements of oncogenic pathways such as PI3K/AKT and BCL2, which offers a promising new combination therapy for high-risk Neuroblastoma (NB). PMID: 26996667
  30. A breakdown in a BRCA/FANCD2/BRG1/SNF-DeltaNP63-mediated DNA repair and differentiation maintenance process in mammary epithelial cells may contribute to sporadic breast cancer development. PMID: 27373334
  31. both ABCB1 upregulation and doxorubicin resistance caused by SMARCB1 loss were dependent on the function of SMARCA4, a catalytic subunit of the SWI/SNF complex. PMID: 27503929
  32. BRG1 participates in gene repression by interacting with H1.2, facilitating its deposition and stabilizing nucleosome positioning around the transcription start site. PMID: 27390128
  33. Cdx members interact with the SWI-SNF complex and make direct contact with Brg1, a catalytic member of SWI-SNF. Both Cdx2 and Brg1 co-occupy a number of Cdx target genes, and both factors are necessary for transcriptional regulation of such targets. Finally, Cdx2 and Brg1 occupancy occurs coincident with chromatin remodeling at some of these loci. PMID: 28082674
  34. Small-cell carcinoma of the ovary of hypercalcemic type is characterized by deleterious germline or somatic mutations in SMARCA4. PMID: 27241105
  35. induce apoptosis and suppresses inflammation in MH7A rheumatoid fibroblast-like synoviocyte cells PMID: 28002318
  36. BRG1 is involved in the progression and metastasis of breast cancer and can serve as a novel biomarker predictive of distant metastasis and patient outcomes. PMID: 27630343
  37. Results provide evidence that BRG1 and SMARCAL1 regulate each other. BRG1 binds to the SMARCAL1 promoter, while SMARCAL1 binds to the brg1 promoter. During DNA damage, the occupancy of SMARCAL1 on the brg1 promoter increases coinciding with an increase in BRG1 occupancy on the SMARCAL1 promoter, leading to increased brg1 and SMARCAL1 transcripts respectively. PMID: 26843359
  38. The CRISPR/Cas9 system may control a pro-oncogenic splicing process through the exclusion of EDA exon from the FN gene, leading to inhibition of motility, invasion and proliferation of cancer cells. PMID: 25684411
  39. Knock down of BRG1 in resistant cells restored sensitivity to retinoic acid-mediated differentiation, from early gene expression to terminal functional capacity. PMID: 26997274
  40. Data indicate that SMARCA4 protein inactivation is the main cause of small cell carcinoma of the ovary, hypercalcemic type (SCCOHT). PMID: 26646792
  41. Activation of DPF3a upon hypertrophic stimuli in cardiac hypertrophy switches cardiac fetal gene expression from being silenced by HEY to being activated by BRG1. PMID: 26582913
  42. These results suggest that ARPE-19 cells possess an AHR-mediated transcription pathway with different target gene specificity, and that BRG1 is required for AHR-mediated transcription in ARPE-19 cells. PMID: 26966070
  43. Brg-1 inhibits the transcriptional activity of miR-550a-5p promoter, and decreased Brg-1 expression increased miR-550a-5p expression. PMID: 25961913
  44. these data uncover a direct regulatory relationship between miR-302 and the Brg1 chromatin remodeling complex that controls gene expression and cell fate decisions in hESCs and suggests that similar mechanisms are at play during early human development PMID: 26119756
  45. The results do not support our hypothesis that common germline genetic variants in the SMARCA4 genes is associated with the risk of developing medulloblastoma. PMID: 26290144
  46. Loss of SMARCA4 expression is sensitive/specific for the diagnosis of small cell carcinoma of ovary, hypercalcemic type. PMID: 26645725
  47. SMARCA4 is involved in the TOP1 recruitment to general chromatin, which suppresses transcription-associated genomic instability. PMID: 26842758
  48. BRG1 overexpression might promote the development of thoracic aortic dissection by increasing MMP2/MMP9 expression, inducing smooth apoptosis and the transition from contractile to synthetic phenotype. PMID: 25304030
  49. Case Report: small cell carcinoma of the ovary, hypercalcemic type (SCCOHT) with SMARCA4 germline mutations. PMID: 26230154
  50. High level of BRG1, the same E2F binding motifs were docking sites for BRG1, induced chromatin compaction without CpG methylation but with increased histone deacetylation, associated with the presence of HDAC1 on E2F binding sites. PMID: 25724006
  51. This study suggests that some women develop the ovarian SCCHT due to the inherited or possibly de novo-occurring germline alterations in the SMARCA4 gene, however, its penetrance appears limited. PMID: 25886974
  52. prospective recruitment of cases confirmed this new category of 'SMARCA4-deficient thoracic sarcomas' as readily recognizable in clinical practice, providing opportunities to tailor their therapeutic management PMID: 26343384
  53. MITF-BRG1 interplay thus plays an essential role in transcription regulation in melanoma. PMID: 25803486
  54. tetrandrine may inhibit the growth of Hep-2 cells by decreasing the intracellular concentration of Ca2+ and upregulating the expressions of Brg1 and AHNAK PMID: 26642721
  55. BRG1 regulates transcriptional expression of many genes involved in cell stress response. PMID: 25157878
  56. We reveal that SMARCA4 expression is regulated by miR-101, miR-199 and especially miR-155 through their binding to two alternative 3'UTRs. PMID: 25355421
  57. Studied BRG1 expression in thoracic aortic aneurysms and the roles of BRG1 and the lncRNA HIF 1 alpha-antisense RNA 1 in regulating the proliferation and apoptosis of aortic smooth muscle cells in vitro. PMID: 24875884
  58. Lack of BRG1 expression is a useful tool for diagnosing ovarian small cell carcinomas of the hypercalcemic type. PMID: 26135561
  59. This work therefore identifies BRG1-BRD as a novel tumor radiosensitizer. PMID: 25504753
  60. Data showed that BRG1 as target protein of UCA1 with anti-oncogenic features in bladder cancer cells. UCA1 blocked recruitment of BRG1 to its target promoter, and thus led to reduced expression of p21 and accelerated cell growth. PMID: 24993775
  61. Mutations in Coffin-Siris syndrome, a human intellectual disability disorder, localize to the BRG1 RNA-binding and DLX1-binding domains. PMID: 26138476
  62. The phosphorylation level of Brg1 at Ser1452 was down-regulated in ovarian clear cell adenocarcinoma. PMID: 25083560
  63. A direct interaction between Ku70/86 and BRG1 brings together SWI/SNF remodeling capabilities and TOP2beta activity to enhance the transcriptional response to hormone stimulation. PMID: 26055322
  64. SMARCA4-associated CSS is a pleiotropic disorder in which the pathognomic clinical features evolve and for which the few reported individuals do not demonstrate a clear genotype-phenotype correlation. PMID: 24700502
  65. BRG1/HDAC2 and beta-catenin constitute a manipulative apparatus at the transcription start site to play opposite but complementary roles in regulating hTERT expression. PMID: 25486475
  66. BAF complex gene SMARCA4 is mutated in Coffin-Siris syndrome patients. PMID: 25081545
  67. Genotype-phenotype correlation of Coffin-Siris syndrome caused by mutations in SmarCA4 gene. PMID: 25168959
  68. results offer direct evidence that BRG1 attenuation contributes to non-small cell lung cancer aggressiveness by altering nucleosome positioning at a wide range of genes, including key cancer-associated genes PMID: 25115300
  69. PRC2 may inhibit immune surveillance, and it could be targeted to reactivate CIITA expression in SWI/SNF deficient cancers. PMID: 25862816
  70. Biallelic somatic SMARCA4 mutations in small cell carcinoma of the ovary, hypercalcemic type (SCCOHT). PMID: 25307865
  71. The genetic alterations of SMARCA4 in AT/RT are associated with a high rate of inherited germline mutations and aggressive biological behavior. PMID: 25060813
  72. BRG1 deficiency compromises the differentiation potential of human embryonic stem cells. PMID: 25241744
  73. Data indicate that ataxia telangiectasia mutated (ATM) protein phosphorylates BRG1 protein at Ser-721. PMID: 24413084
  74. A reduction in the number of oligodendrocytes with myelin gene expression in the absence of Brg1 was identified. PMID: 25568100
  75. SMARCB1, SMARCA4, or ARID1B were mutated in 20 out of 49 Coffin-Siris syndrome patients. PMID: 23815551
  76. Results show that BRG1 regulates the expression of MAX through direct recruitment to the MAX promoter, and that depletion of BRG1 strongly hinders cell growth in small cell lung cancer. PMID: 24362264
  77. SMARCA4 rs11879293 presented consistently significant associations with the risk of hepatocellular carcinoma PMID: 24556940
  78. Brg1 provides the crucial epigenetic link to hypoxia-induced CAM induction and leukocyte adhesion that engenders endothelial malfunction and pathogenesis of hypoxic pulmonary hypertension. PMID: 24042015
  79. Small cell carcinoma of the ovary, hypercalcemic type, displays frequent inactivating germline and somatic mutations in SMARCA4. PMID: 24658001
  80. Germline and somatic SMARCA4 mutations characterize small cell carcinoma of the ovary, hypercalcemic type. PMID: 24658002
  81. Inactivating biallelic SMARCA4 mutations found in 100% of the 12 small cell carcinoma of the ovary, hypercalcemic type-tumors examined. PMID: 24658004
  82. Allele T of rs1122608 was associated with an increased expression level of SFRS3 encoding an mRNA splicing regulator, but not with the expression of BRG1/SMARCA4 or LDLR PMID: 24190014
  83. The Brahma-related gene 1 (BRG1) was observed to selectively activate interferon-induced transmembrane protein 1 and interferon alpha-inducible protein 27 genes. PMID: 23836109
  84. We demonstrated that BRG1 regulates the expression of the MYC-associated factor X gene, MAX, through direct recruitment to the MAX promoter, and that depletion of BRG1 strongly hinders cell growth, specifically in MAX-deficient cells, heralding a synthetic lethal interaction. Furthermore, MAX required BRG1 to activate neuroendocrine transcriptional programs and to upregulate MYC targets, such as glycolysis-related genes. PMID: 24362264
  85. The BRG1 gene is recurrently inactivated in non small cell lung cancer. Mutations were detected in 24% of the lung cancer cell lines. All mutations were homozygous and most predicted truncated proteins. Alterations at BRG1 always occurred in the absence of MYC amplification, suggesting a common role in lung cancer development. PMID: 18386774
  86. Loss of BRG1 expression is associated with lung cancer PMID: 23872584
  87. BRG1 regulates ML-IAP expression by cooperating with MITF to promote transcriptionally permissive chromatin structure on the ML-IAP promoter. PMID: 23480510
  88. The results highlight the importance of BRG1 in breast cancer pathogenesis and BRG1 may serve as a prognostic marker as well as a potentially selective therapeutic target. PMID: 23533649
  89. SMARCA4 rs11672232 and rs12232780 were associated with oligodendroglioma risk. PMID: 23276717
  90. Data suggests that loss of BRG1-based SWI/SNF complexes negatively affects survival pathways beyond the MITF cascade. PMID: 23349796
  91. Data indicate three point mutations of KDM6A in Kabuki syndrome (KS). PMID: 23076834
  92. studies indicate that the ability of TOP2A to prevent DNA entanglement at mitosis requires BAF complexes and suggest that this activity contributes to the role of BAF subunits as tumour suppressors PMID: 23698369
  93. BRG1 enhances senescence induced by BRCA1 knockdown. PMID: 23438604
  94. Although deletions and mutations in BRG1 gene were identified, the role of BRG1 in hepatocellular carcinoma tumourigenesis remains unclear. PMID: 23088494
  95. The beta-actin-Arp4 complex formation might be a crucial feature in some chromatin-modifying enzyme complexes, such as the Brg1 complex. PMID: 22573825
  96. a mechanism in which Brg1-containing SWI/SNF complexes are required for myocardin to induce expression of miRs-143/145 in smooth muscle cells PMID: 23339192
  97. E2F6 may recruit BRG1 in transcriptional regulation of genes important for G1/S phase transition of the cell cycle. PMID: 23082233
  98. BRG1 is highly activated in Schwann cells at early stages of myelination, and loss of the enzyme inhibits their differentiation. PMID: 23392668
  99. BRG1 inactivation contributes to cancer by maintaining undifferentiated gene expression programs. PMID: 22407764
  100. Sox10 functions in Schwann cells by recruiting Brg1-containing chromatin-remodeling complexes. PMID: 22814607

Show More

Hide All

Involvement in disease Rhabdoid tumor predisposition syndrome 2 (RTPS2); Coffin-Siris syndrome 4 (CSS4)
Subcellular Location Nucleus
Protein Families SNF2/RAD54 helicase family
Tissue Specificity Colocalizes with ZEB1 in E-cadherin-negative cells from established lines, and stroma of normal colon as well as in de-differentiated epithelial cells at the invasion front of colorectal carcinomas (at protein level).
Database Links

HGNC: 11100

OMIM: 603254

KEGG: hsa:6597

STRING: 9606.ENSP00000350720

UniGene: Hs.327527

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1