Recombinant Human Transcription cofactor vestigial-like protein 3(VGLL3)

Code CSB-YP025850HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. A8MV65
Relevance May act as a specific coactivator for the mammalian TEFs.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
Research Area Transcription
Source Yeast
Gene Names VGLL3
Protein Names Recommended name: Transcription cofactor vestigial-like protein 3 Short name= Vgl-3
Expression Region 1-320aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 37.2kDa
Protein Description Full Length of Isoform 2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May act as a specific coactivator for the mammalian TEFs.
Subcellular Location Nucleus
Protein Families Vestigial family
Tissue Specificity Enriched in placenta.
Database Links

HGNC: 24327

OMIM: 609980

KEGG: hsa:389136

STRING: 9606.ENSP00000381436

UniGene: Hs.606507

Related Products

VGLL3 Proteins

VGLL3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.