Recombinant Human Transcription cofactor vestigial-like protein 3(VGLL3)

Code CSB-YP025850HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names VGLL3
Uniprot No. A8MV65
Research Area Transcription
Alternative Names VGLL3; Transcription cofactor vestigial-like protein 3; Vgl-3
Species Homo sapiens (Human)
Source Yeast
Expression Region 1-320aa
Target Protein Sequence MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 37.2kDa
Protein Length Full Length of Isoform 2
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May act as a specific coactivator for the mammalian TEFs.
Gene References into Functions
  1. this study identified a VGLL3-regulated network as a previously unknown inflammatory pathway that promotes female-biased autoimmunity PMID: 27992404
  2. VGLL3 is involved in tumor suppressor pathways, a feature that is characterized by the absence of VGLL3 expression in high-grade serous ovarian carcinomas samples. PMID: 23415753
  3. vestigial-like 3 (Vgll3) is an inhibitor of adipogenesis PMID: 23152581
  4. data suggest that the amplification and overexpression of YAP1 and VGLL3 could be involved in oncogenesis and progression of soft tissue sarcomas PMID: 20842732
  5. This protein was named Vestigial-like 3, because it is related to the Drosophila protein Vestigial. Like other members of this family, it contains a consensus TEF-1 and MEF2(TDU)interaction domain. PMID: 12376544

Show More

Hide All

Subcellular Location Nucleus
Protein Families Vestigial family
Tissue Specificity Enriched in placenta.
Database Links

HGNC: 24327

OMIM: 609980

KEGG: hsa:389136

STRING: 9606.ENSP00000381436

UniGene: Hs.606507

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1