Recombinant Human Transcription cofactor vestigial-like protein 3 (VGLL3)

Code CSB-YP025850HU
Abbreviation Recombinant Human VGLL3 protein
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transcription
Alternative Names
VGLL3; Transcription cofactor vestigial-like protein 3; Vgl-3
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-320aa
Target Protein Sequence
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.2kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

A cDNA encoding residues Met1 to Ser320 of the human Transcription cofactor vestigial-like protein 3 (VGLL3) full-length protein was fused with a 6xHis-tag at the N-terminus and then expressed in the yeast. The forming recombinant protein was validated by SDS-PAGE. Its purity is greater than 90%. On the reducing SDS-PAGE gel, the VGLL3 protein migrated on the molecular mass band of approximately 38 kDa. The slightly higher result is attributed to glycosylation. This recombinant VGLL3 protein can act as the immunogen to produce specific antibodies. Besides, it also may be used in the studies of VGLL3-associated transcription.

VGLL3 is a co-activator of mammalian toxicity equivalency factors (TEFs). It has reported participating in the proliferation of sarcoma and breast tumor cells. Studies revealed that VGLL3 expression was positively correlated with poor prognostic outcome in patients with gastric tumor. And gastric tumor with high levels of VGLL3 showed the activation of the MAPK, JAK-STAT, and WNT pathways together with enhanced immune infiltrates.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May act as a specific coactivator for the mammalian TEFs.
Gene References into Functions
  1. this study identified a VGLL3-regulated network as a previously unknown inflammatory pathway that promotes female-biased autoimmunity PMID: 27992404
  2. VGLL3 is involved in tumor suppressor pathways, a feature that is characterized by the absence of VGLL3 expression in high-grade serous ovarian carcinomas samples. PMID: 23415753
  3. vestigial-like 3 (Vgll3) is an inhibitor of adipogenesis PMID: 23152581
  4. data suggest that the amplification and overexpression of YAP1 and VGLL3 could be involved in oncogenesis and progression of soft tissue sarcomas PMID: 20842732
  5. This protein was named Vestigial-like 3, because it is related to the Drosophila protein Vestigial. Like other members of this family, it contains a consensus TEF-1 and MEF2(TDU)interaction domain. PMID: 12376544

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Vestigial family
Tissue Specificity
Enriched in placenta.
Database Links

HGNC: 24327

OMIM: 609980

KEGG: hsa:389136

STRING: 9606.ENSP00000381436

UniGene: Hs.606507

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*