Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Transcription
Alternative Names
VGLL3; Transcription cofactor vestigial-like protein 3; Vgl-3
Species
Homo sapiens (Human)
Expression Region
1-320aa
Target Protein Sequence
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
A cDNA encoding residues Met1 to Ser320 of the human Transcription cofactor vestigial-like protein 3 (VGLL3) full-length protein was fused with a 6xHis-tag at the N-terminus and then expressed in the yeast. The forming recombinant protein was validated by SDS-PAGE. Its purity is greater than 90%. On the reducing SDS-PAGE gel, the VGLL3 protein migrated on the molecular mass band of approximately 38 kDa. The slightly higher result is attributed to glycosylation. This recombinant VGLL3 protein can act as the immunogen to produce specific antibodies. Besides, it also may be used in the studies of VGLL3-associated transcription.
VGLL3 is a co-activator of mammalian toxicity equivalency factors (TEFs). It has reported participating in the proliferation of sarcoma and breast tumor cells. Studies revealed that VGLL3 expression was positively correlated with poor prognostic outcome in patients with gastric tumor. And gastric tumor with high levels of VGLL3 showed the activation of the MAPK, JAK-STAT, and WNT pathways together with enhanced immune infiltrates.
