Recombinant Human Transcription regulator protein BACH2 (BACH2), partial

In Stock
Code CSB-EP883639HU
Abbreviation Recombinant Human BACH2 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
BACH2
Uniprot No.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
618-770aa
Target Protein Sequence
PVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional regulator that acts as repressor or activator. Binds to Maf recognition elements (MARE). Plays an important role in coordinating transcription activation and repression by MAFK. Induces apoptosis in response to oxidative stress through repression of the antiapoptotic factor HMOX1. Positively regulates the nuclear import of actin. Is a key regulator of adaptive immunity, crucial for the maintenance of regulatory T-cell function and B-cell maturation.
Gene References into Functions
  1. The authors show that the timed repression of BACH2 through IL-2-mediated ERK/ELK1 signalling pathway directs plasma cell lineage commitment. PMID: 29129929
  2. The epithelial-mesenchymal transition (EMT) pathway was also influenced by miR-130a-3p down-regulation. In conclusion, miR-130a-3p could bind to BACH2, inhibit nasopharyngeal carcinoma cell abilities, and promote cell apoptosis. PMID: 28487475
  3. Ikaros regulates expression of the BCL6/BACH2 axis in acute lymphoblastic leukemia cells. PMID: 28030830
  4. Data show that BACH2 and STAT5B are activated by viral insertions, generating chimeric mRNAs specifically enriched in T regulatory cells favoring their persistence. PMID: 28887441
  5. BACH2 downregulation contributes to constitutive activation of the nuclear factor-kappaB. PMID: 28256087
  6. BACH2 haploinsufficiency causing a syndrome of immune deficiency and autoimmunity is described in two families. Affected subjects had lymphocyte-maturation defects that caused immunoglobulin deficiency and intestinal inflammation. PMID: 28530713
  7. In this study silencing BACH2 in mantle cell lymphoma cells resulted in increased proliferation and enhanced tumor dispersal in hypoxic microenvironments, suggesting a tumor suppressor-like role of BACH2. PMID: 28592433
  8. we developed a CRISPR-Cas9-based tool for specific DNA methylation consisting of deactivated Cas9 (dCas9) nuclease and catalytic domain of the DNA methyltransferase DNMT3A targeted by co-expression of a guide RNA to any 20 bp DNA sequence followed by the NGG trinucleotide.we demonstrated that directed DNA methylation of a wider promoter region of the target loci IL6ST and BACH2 decreased their expression PMID: 26969735
  9. genetic association studies in population in the United Kingdom: Data suggest that an SNP in BACH2 (rs3757247) is associated with autoimmune Addison's disease and with polyglandular autoimmune syndrome type 2. These findings were replicated in a Norwegian validation cohort. PMID: 27680876
  10. The shift in the CSDs by heme binding suggested that heme binding causes Bach2(331-520) to adopt a more compact conformation. In addition, heme binding to the CP-motif could reduce the flexibility of Bach2(331-520) Consequently, the five-coordinated heme binding destabilizes Bach2(331-520), by reducing the flexibility of the polypeptide chain. PMID: 27206783
  11. The study identifies a strong association of Coeliac Disease with a network of BACH2 regulated genes, supporting emerging evidence of an important role of BACH2 in the regulation of T cell differentiation and prevention of autoimmune disease. PMID: 26444573
  12. The investigated Bach2 gene polymorphisms (rs11755527, rs3757247, rs12212193 and rs2474619) are not related to the susceptibility to either Vogt-Koyanagi-Harada syndrome and Behcet's disease in our investigated Chinese Han population. PMID: 25873652
  13. Gene expression analysis revealed that three gene BACH2, PTGER4 and ZFP36L1, are down-regulated in MS patients' blood cells compared to healthy subjects. PMID: 25670004
  14. These observations suggested that the unstructured region of Bach2 is important for heme binding, and consequently for its functional regulation PMID: 25444856
  15. A restored BACH2 expression in BACH2-silenced gastric cancer cell lines, and knockdown of BACH2 using short hairpin RNA (i.e. RNA interference) increased cell proliferation in gastric cancer cells. PMID: 24858026
  16. The type 1 diabetes candidate gene BACH2 regulates proinflammatory cytokine-induced apoptotic pathways in pancreatic beta-cells by crosstalk with another candidate gene, PTPN2, and activation of JNK1 and BIM. PMID: 24608439
  17. The dynamics of Bach2 expression in response to DNA damage shows that it is a highly sensitive responder to transcription-blocking DNA lesions. PMID: 24075570
  18. BACH2 expression level is a promising predictor of prognosis for diffuse large B cell lymphoma. PMID: 24450488
  19. Our study clearly demonstrated that BACH2 is a susceptibility gene for GD in the Chinese Han population PMID: 24346624
  20. Lower levels of BACH2 is associated with drug resistance in mantle cell lymphoma. PMID: 23936317
  21. our data suggest that BACH2 may play an essential role for somatic hypermutation of the Ig gene in B-cell lymphoma PMID: 23865571
  22. This study provides robust evidence for an association of rheumatoid arthritis susceptibility with genes involved in B cell differentiation (BACH2) and DNA repair (RAD51B). PMID: 24022229
  23. BACH2 competes with BCL6 for promoter binding and reverses BCL6-mediated repression of p53 and other cell cycle checkpoint-control genes. PMID: 23852341
  24. Downregulation of BACH2 mediated by Bcr-Abl oncoprotein via PAX5 is associated with chronic myeloid leukaemia. PMID: 22858985
  25. crystal structure of the human Bach2 POZ domain is reported at 2.1 A resolution PMID: 22194330
  26. This is the first report that shows the involvement of both BCL2L1 and the transcription factor BACH2 in a chromosomal rearrangement. PMID: 21412927
  27. BACH2 is transcriptionally regulated by the BCR/ABL oncogene. PMID: 11746976
  28. antineoplastic drugs that were oxidative stressors induced the nuclear accumulation of BACH2 PMID: 12829606
  29. loss of BACH2 expression through Epstein-Barr virus integration might contribute to lymphomagenesis PMID: 14982850
  30. Results demonstrate that transcription activity associated with PML bodies is selectively repressed by the recruitment of Bach2 around PML bodies. PMID: 15060166
  31. Upregulation of BACH2 is associated with ovarian cancer PMID: 16832351
  32. Bach2 is phosphorylated on S521 via Bcr-Abl signaling thru the phosphatidylinositol-3/S6 kinase pathway,and transcriptionally represses heme oxygenase-1 PMID: 17018862
  33. down-regulation of the BACH2 gene through the interaction with centromeric heterochromatin would take part in leukomogenesis of BCR-ABL positive lymphoid leukemia. PMID: 17044046
  34. This study demonstrated strong integration clusters in the BACH2 gene were observed in 2 HIV infection patients without detectable viremia. PMID: 17262715
  35. expression of the silencing mediator of retinoid and thyroid receptor (SMRT) & histone deacetylase4 (HDAC4) enhances formation of Bach2 foci in nuclear matrix. SMRT mediates HDAC4 binding to Bach2, & HDAC4 facilitates the retention of Bach2 in the foci. PMID: 17383980
  36. This study demonstrates a novel role for Bach2 as a key regulator of nucleic acid-triggered antiviral responses in human cells. PMID: 17991429
  37. reporter assays demonstrated that Bach2 and Bcl6 cooperate to repress Prdm1 through its intron enhancer region PMID: 18256039
  38. BACH2 expression is necessary to maintain IL-2 production when NFAT1 protein is reduced, potentially impacting umbilical cord blood graft CD4(+) T-cell allogeneic responses PMID: 18769450
  39. BACH2 may be partially responsible for regulation of BCL2 expression from the t(14;18)(q21;q34) translocation PMID: 18929412

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
BZIP family, CNC subfamily
Tissue Specificity
B-cell specific.
Database Links

HGNC: 14078

OMIM: 605394

KEGG: hsa:60468

STRING: 9606.ENSP00000257749

UniGene: Hs.269764

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*