Recombinant Human Trefoil factor 3 (TFF3),partial

In Stock
Code CSB-YP023433HU
Abbreviation Recombinant Human TFF3 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TFF3
Uniprot No.
Research Area
Signal Transduction
Alternative Names
hITF; hP1.B; Intestinal trefoil factor; ITF; mITF; OTTMUSP00000021729; P1B; Polypeptide P1.B; TFF3; TFF3_HUMAN; TFI; TREFOIL; Trefoil factor (intestinal); Trefoil factor 3
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
29-80aa
Target Protein Sequence
LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
7.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Trefoil factor 3 (TFF3) is produced using a yeast expression system and provided as a partial protein covering the 29-80 amino acid region. The protein includes an N-terminal 6xHis-tag, which streamlines purification and detection processes. This product achieves purity greater than 90% as confirmed by SDS-PAGE analysis, suggesting reliable performance for research applications.

Trefoil factor 3 (TFF3) belongs to the trefoil factor family and appears to play a crucial role in mucosal protection and repair. It primarily maintains the integrity of epithelial surfaces. Researchers study TFF3 for its potential involvement in wound healing and mucosal defense, making it an important focus in gastrointestinal research and epithelial biology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant human TFF3 is produced in a yeast expression system as a partial fragment (29-80aa) with an N-terminal 6xHis-tag. TFF3 is a small secretory protein that requires precise folding and disulfide bond formation for its biological activity in mucosal protection and repair. Yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation, which is critical for TFF3's stability and function. However, the partial nature of the fragment (missing the signal peptide and potentially critical regions) and the presence of the His-tag may affect proper folding. No validation data (e.g., receptor binding assays, circular dichroism) are provided. Therefore, while yeast expression increases the probability of correct folding compared to prokaryotic systems, the protein's folding status and bioactivity cannot be confirmed without experimental validation.

1. Antibody Development and Validation Studies

This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The high purity and defined fragment support consistent immunization results. However, if correctly folded, antibodies may recognize conformational epitopes relevant to native TFF3; if misfolded, generated antibodies might not optimally bind the full-length protein in biological contexts, limiting utility for functional studies.

2. Protein-Protein Interaction Studies

If correctly folded, the His-tagged TFF3 fragment could be used in pull-down assays to identify binding partners, as proper folding is essential for biologically relevant interactions. However, if misfolded, interaction domains may be altered, leading to non-specific binding or failure to recognize genuine biological partners. The partial nature may also lack key interaction sites present in full-length TFF3.

3. Structural and Biochemical Characterization

If properly folded, the fragment is suitable for limited structural studies of this specific domain. However, if misfolded, structural data would misrepresent the native protein's architecture. The small size and His-tag may limit insights into full-length TFF3 behavior and interfere with some structural analyses.

4. ELISA Standard and Quantification Assays

If correctly folded, the recombinant TFF3 can serve as a standard in ELISA assays for quantification. However, if misfolded, it may not accurately represent native protein epitopes, potentially leading to inaccurate standard curves. The His-tag can be used for capture, but may affect antibody binding if the tag interferes with epitope presentation.

Final Recommendation & Action Plan

Before employing this recombinant TFF3 fragment in any application, it is essential to validate its folding and bioactivity through biophysical methods (e.g., circular dichroism for secondary structure, mass spectrometry for disulfide bond analysis) and functional assays (e.g., receptor binding or cell migration assays); if validation confirms proper folding and function, proceed with applications while noting the limitations of the partial fragment; if misfolded, consider using full-length TFF3 expressed in mammalian systems for better physiological relevance or obtain a commercially validated standard; for immediate use, antibody development can proceed with the understanding that antibodies may require additional validation against native protein; avoid functional studies until proper folding is confirmed. Always include appropriate controls (e.g., native TFF3, known ligands) in experiments to ensure reliability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
Gene References into Functions
  1. TFF3 located in the renal tubular epithelial cells may play a role in the progression of tubulointerstitial fibrosis in IgA nephropathy patients. PMID: 29987860
  2. Authors hypothesised that TFF3 may involve regulatory networks of ncRNAs to exert its effects as a scattering factor. PMID: 28277538
  3. The highly specific expression of TFF3 in mucinous ovarian cancer may help to further clarify potential relationships of tumors with mucinous histology PMID: 28470574
  4. This is, to our knowledge, the first report of decreased expression of TFF3, SPDEF, KLF4, and goblet cell population in the colon of patients with HSCR. Altered goblet cell function may result in intestinal barrier dysfunction contributing to the development of HAEC. PMID: 29383490
  5. High TFF3 expression is associated with oncogenicity and chemoresistance in hepatocellular carcinoma. PMID: 28445151
  6. Results indicate diagnostic biomarker potential of Trefoil factor 3 (TFF3) promoter hypomethylation for prostate cancer (PC) as well as prognostic biomarker potential of TFF3 RNA expression. PMID: 28930171
  7. ITF role in promoting intestinal epithelial cells migration through crosstalk between the ERK and JAK/STAT3 pathways PMID: 27616044
  8. TFF3 levels were significantly elevated in patients with stage I (p= 0.001) and T1 gastric cancer (p= 0.013). PMID: 28453457
  9. The present study demonstrated a negative association between the expression of miR75p and TFF3 in IBD lesional tissues and normal tissues. In conclusion, TFF3 was identified as a novel target of miR75p PMID: 28627600
  10. trefoil factors family 3 may have a role in colorectal cancer PMID: 28405143
  11. This study provides the first evidence that TFF3 is locally elevated in the peritoneal cavity in endometriosis and might play a role in disease pathogenesis and its associated inflammatory processes. Furthermore, the results show that TFF3 is regulated through the menstrual cycle. PMID: 27330011
  12. involvement of TFF3 in the pathogenesis of rhonchopathy and OSA PMID: 29028798
  13. Giardia co-infection promotes the secretion of antimicrobial peptides beta-defensin 2 and trefoil factor 3 and attenuates attaching and effacing bacteria-induced intestinal disease.( PMID: 28622393
  14. expression reduces growth, viability, and tumorigenicity of retinoblastoma cell oines PMID: 27626280
  15. The expression of TFF3 and TWIST1 might be associated with the survival of patients with colorectal cancer (CRC) after curative resection and might be pivotal predictors of disease progression. TFF3 may be correlated to the invasiveness of CRC. PMID: 28104986
  16. Serum TFF-3 is not a convenient and reliable surrogate marker of mucosal healing during therapy with TNF-alpha antagonists in Crohn's disease. PMID: 28104989
  17. TFF3 levels differed among idiopathic pulmonary fibrosis, pulmonary sarcoidosis and chronic pulmonary obstructive disease. PMID: 27758987
  18. TFF3 protein knockout can facilitate apoptosis of human pituitary adenoma HP75 cells via mitochondrial pathway PMID: 26823779
  19. Data show that trefoil factor-3 (TFF3) secreted from mammary carcinoma cells promotes de novo angiogenesis via interleukin-8 (IL-8)/IL-8 receptor CXCR2. PMID: 26559818
  20. Dimers CXCR4 and CXCR7 are involved in TFF3-dependent activation of cell migration, but not cell proliferation. The ERK1/2 pathway is activated in the process, but not influenced by CXCR4 or CXCR7. PMID: 26780310
  21. TFF3 expression is associated with response to endocrine therapy, and outperforms oestrogen receptor, progesterone receptor and TFF1 as an independent biomarker, possibly because it mediates the malign effects of oestrogen on invasion and metastasis PMID: 25900183
  22. the results provide a mechanistic explanation for ITF-mediated protection of gastric epithelial mucosa cells, suggesting that activation of the ERK1/2 signaling pathway may provide a new therapeutic strategy for repairing gastric injury. PMID: 25776570
  23. primary outcome measures were to evaluate the safety, acceptability, and accuracy of the Cytosponge-TFF3 test compared with endoscopy and biopsy. In all, 1,042 (93.9%) patients successfully swallowed the Cytosponge, and there were no serious side effects PMID: 25634542
  24. TFF3 is not only a useful biomarker for a long-term surgical result in CRC patient, but also may be a risk factor of early recurrence. PMID: 25405728
  25. Associations discovered between trefoil factor 3 gene variants and idiopathic recurrent spontaneous abortion. PMID: 25444508
  26. TFF3 expression predicts metastasis and poor survival outcome of patients with mammary carcinoma. PMID: 25266665
  27. TFF3 expression may be absent in the early stages of Barrett's esophagus and its expression may represent more established columnar epithelium. PMID: 25424203
  28. This study suggests that TFF3 is an independent indicator for survival in GC, while HER2 is not associated with the outcome. Patients with HER2-negative/TFF3-negative GC have the best outcome. PMID: 25514872
  29. High TFF3 expression is associated with reduces sensitivity to ionising radiation in prostate carcinoma. PMID: 25748388
  30. Study supports the notion that ITF can promote cell proliferation, migration and preserve epithelium integrity. PMID: 24990304
  31. LRP2 sequencing reveals multiple rare variants associated with urinary trefoil factor-3 PMID: 24876117
  32. Serum concentrations of TFF3 is significantly higher in chronic kidney disease. PMID: 24282531
  33. TFF3 expression at both mRNA and protein levels was significantly downregulated by ErbB-2 silencing in breast cancer cell lines PMID: 24164280
  34. A significantly higher trefoil factor 3 expression in luminal epithelial cells was detected in women with unexplained infertility PMID: 24228773
  35. TFF3 point mutations seem to be a rare event in colorectal carcinogenesis; TFF3 expression may play a role in promoting lymph node metastases of CRCs. PMID: 24125969
  36. TFF3 is an independent indicator for overall survival in gastric cancer. PMID: 23822993
  37. In serum TFFs and pepsinogen tests, only serum TFF3s were not significantly affected by H. pylori eradication, suggesting that serum TFF3 could be a stable biomarker of gastric cancer risk even after H.pylori eradication PMID: 22907485
  38. TFF3 hypermethylation is associated with triple-negative breast cancers. PMID: 24045095
  39. interaction between DMBT1(gp340) and trefoil TFFs proteins was investigated using an ELISA assay. DMBT1(gp340) bound to solid-phase bound recombinant dimeric TFF3 in a calcium dependent manner PMID: 23691218
  40. ER+ /PR+ /TFF3+ /IMP3- immunoprofile distinguishes endometrioid from serous and clear cell carcinomas of the endometrium. PMID: 23570281
  41. Using a Caco-2 cell model the study showed that TLR2 and TFF3 inhibit the IL-1beta induced increase in permeability and release of proinflammatory cytokines, and that this effect is mediated by activation of PI3K/Akt signaling. PMID: 24051092
  42. Distinct ERG and TFF3 protein was expressed in 45% (43/96) and 36% (35/96) of prostate cancers, respectively. PMID: 23856515
  43. Our study suggests that Twist, as an important potential downstream effector, plays a key role in TFF3-modulated metastasis in gastric cancer and can be a promising therapeutic target against intestinal-type gastric cancer. PMID: 23845905
  44. TFF3 activated the epithelial cells in culture to produce beta defensins 2 (hBD2) and beta defensins 4 PMID: 23198942
  45. TFF3 seems to be a novel pathway in the pathogenesis of type I endometrial carcinomas. PMID: 23578537
  46. Upregulation of TFF3 after chemoradiotherapy for rectal cancer is associated with a higher risk of relapse. The physiological role of TFF3 in restoring the mucosa during CRT could be interfering with treatment efficacy. PMID: 22516806
  47. Measurement of TFF3 mRNA in aspirates from thyroid nodules using mesh filtration. PMID: 22572548
  48. TFF3 may contribute to ocular surface wound healing after Amniotic membrane transplantation, but its production by AM is not further inducible by proinflammatory stimuli. PMID: 22476621
  49. Report TFF3 expression in normal/diseased pancreas. PMID: 22286382
  50. Differential expression of MUC5AC involves crosstalk between interleukin-1beta and Akt, whereby the trefoil factor family peptide TFF3 activates Akt by phosphorylation of EGFR. PMID: 22389405

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix. Cytoplasm.
Tissue Specificity
Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricular, periventricular
Database Links

HGNC: 11757

OMIM: 600633

KEGG: hsa:7033

STRING: 9606.ENSP00000430690

UniGene: Hs.82961

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*