Recombinant Human Tubulin polymerization-promoting protein(TPPP)

Code CSB-EP024115HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O94811
Relevance May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 25 kDa brain-specific protein TPPP/p25 p24 p25-alpha
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
Research Area Signal Transduction
Source E.coli
Gene Names TPPP
Protein Names Recommended name: Tubulin polymerization-promoting protein Short name= TPPP Alternative name(s): 25 kDa brain-specific protein TPPP/p25 p24 p25-alpha
Expression Region 1-219aa
Tag Info N-terminal GST-tagged
Mol. Weight 50.7kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.
Subcellular Location Cytoplasm, Cytoplasm, cytoskeleton, Nucleus
Protein Families TPPP family
Tissue Specificity Widely expressed.
Database Links

HGNC: 24164

OMIM: 608773

KEGG: hsa:11076

STRING: 9606.ENSP00000353785

UniGene: Hs.481466

Related Products

TPPP Antibodies

TPPP Antibodies for Homo sapiens (Human)

TPPP Antibodies for Human

TPPP Proteins

TPPP Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.