Recombinant Human Tumor suppressor candidate 2 (TUSC2)

Code CSB-EP025351HU
Abbreviation Recombinant Human TUSC2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TUSC2
Uniprot No.
Research Area
Cell Biology
Alternative Names
C3orf11; Fus-1 protein; FUS1; Fusion 1 protein; LGCC; PAP; PDAP2; PDGFA associated protein 2; PDGFA-associated protein 2; Tumor suppressor candidate 2; TUSC 2; Tusc2; TUSC2_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-110aa
Target Protein Sequence
GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.9kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.
Gene References into Functions
  1. TUSC2P can suppresses the tumor function of esophageal squamous cell carcinoma by regulating TUSC2 expression and may also serve as a prognostic factor for esophageal squamous cell carcinoma patients. PMID: 30219035
  2. these findings show that the combination of TUSC2-erlotinib induces additional novel vulnerabilities that can be targeted with Auranofin. PMID: 27845352
  3. Data show that TUSC2 is a direct target of miR-584, which is transcriptionally regulated by TWIST1. PMID: 27661106
  4. FOXP1, TP53INP1, TNFAIP3, and TUSC2 were identified as miR-19a targets. PMID: 26367773
  5. The therapeutic activity of TUSC2 could extend the use of erlotinib to lung cancer patients with wildtype EGFR. PMID: 26053020
  6. TUSC2P and TUSC2 3'-UTR expression inhibits cell proliferation, survival, migration, invasion and colony formation, and increases tumor cell death. TUSC2P and TUSC2 3'-UTR bind to miRNAs and arrest their functions, leading to increased TUSC2 translation. PMID: 24394498
  7. The tumor suppressor gene TUSC2 (FUS1) sensitizes NSCLC to the AKT inhibitor MK2206 in LKB1-dependent manner. PMID: 24146957
  8. RNA sequence elements in FUS1 UTRs that regulate FUS1 protein express were identified. PMID: 21645495
  9. Absence of tumor suppressor FUS1 protein expression is associated with bone and soft tissue sarcomas. PMID: 21273575
  10. Data show that the recombinant FUS1 plasmid has been successfully cloned, which allows highly efficient FUS1 expression in E.coli strain Rosetta (DE3)2 plys. PMID: 17545076
  11. The goal of this study was to analyze possible involvement of TUSC2 in malignant pleural mesothelioma. PMID: 19852844
  12. Myristoylation is required for Fus1-mediated tumor-suppressing activity and suggest a novel mechanism for the inactivation of tumor suppressors in lung cancer. PMID: 15126327
  13. These results suggest that miR-378 enhances cell survival, tumor growth, and angiogenesis through repression of the expression of two tumor suppressors, Sufu and Fus-1. PMID: 18077375
  14. FUS1 gene and Fus1 protein abnormalities could be used to develop new strategies for molecular cancer therapy for a significant subset of lung tumors. PMID: 18172250
  15. These results suggest that the three miRNAs are negative regulators of Fus1 expression in lung cancers. PMID: 19671678
  16. Overexpression of candidate tumor suppressor geneFUS1 isolated from the 3p21.3 homozygous deletionregion leads to G1 arrest and growth inhibition oflung cancer cells. PMID: 11593436

Show More

Hide All

Protein Families
TUSC2 family
Tissue Specificity
Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta.
Database Links

HGNC: 17034

OMIM: 607052

KEGG: hsa:11334

STRING: 9606.ENSP00000232496

UniGene: Hs.517981

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*