Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP025351HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | O75896 |
| Relevance | May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Fusion 1 protein |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV |
| Research Area | Cell Biology |
| Source | E.coli |
| Gene Names | TUSC2 |
| Protein Names | Recommended name: Tumor suppressor candidate 2 Alternative name(s): Fusion 1 protein Short name= Fus-1 protein PDGFA-associated protein 2 |
| Expression Region | 1-110aa |
| Tag Info | N-terminal GST-tagged |
| Mol. Weight | 38.9kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells. |
| Protein Families | TUSC2 family |
| Tissue Specificity | Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta. |
| Database Links |
HGNC: 17034 OMIM: 607052 KEGG: hsa:11334 STRING: 9606.ENSP00000232496 UniGene: Hs.517981 |
TUSC2 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA025351GA01HU | TUSC2 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA006814 | TUSC2 Antibody | Human,Mouse | WB,IHC,ELISA |
| CSB-PA946559 | TUSC2 Antibody | Human,Mouse | ELISA,IHC |
TUSC2 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA025351ESR1HU | TUSC2 Antibody | Human | ELISA, IHC |
TUSC2 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP025351HU CSB-BP025351HU CSB-MP025351HU |
Recombinant Human Tumor suppressor candidate 2(TUSC2) | Yeast Baculovirus Mammalian cell |
Recombinant Human Meteorin-like protein(METRNL)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Receptor-type tyrosine-protein phosphatase C(PTPRC),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Mitochondrial import inner membrane translocase subunit Tim8 A(TIMM8A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
