Recombinant Human Tumor suppressor candidate 2(TUSC2)

Code CSB-EP025351HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O75896
Relevance May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Fusion 1 protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
Research Area Cell Biology
Source E.coli
Gene Names TUSC2
Protein Names Recommended name: Tumor suppressor candidate 2 Alternative name(s): Fusion 1 protein Short name= Fus-1 protein PDGFA-associated protein 2
Expression Region 1-110aa
Tag Info N-terminal GST-tagged
Mol. Weight 38.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.
Protein Families TUSC2 family
Tissue Specificity Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta.
Database Links

HGNC: 17034

OMIM: 607052

KEGG: hsa:11334

STRING: 9606.ENSP00000232496

UniGene: Hs.517981

Related Products

TUSC2 Antibodies

TUSC2 Antibodies for Homo sapiens (Human)

TUSC2 Antibodies for Human

TUSC2 Proteins

TUSC2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.