Code | CSB-EP025351HU |
Size | US$1726 |
Image |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | TUSC2 |
Uniprot No. | O75896 |
Research Area | Cell Biology |
Alternative Names | Fusion 1 protein |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 1-110aa |
Target Protein Sequence | GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 38.9kDa |
Protein Length | Full Length |
Tag Info | N-terminal GST-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells. |
Protein Families | TUSC2 family |
Tissue Specificity | Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta. |
Database Links |
HGNC: 17034 OMIM: 607052 KEGG: hsa:11334 STRING: 9606.ENSP00000232496 UniGene: Hs.517981 |
Recombinant Torpedo californica Acetylcholine receptor subunit alpha(CHRNA1),partial
Express system: E.coli
Species: Tetronarce californica (Pacific electric ray) (Torpedo californica)
Recombinant Mouse Guanine nucleotide-binding protein G(o) subunit alpha(Gnao1)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Carbonyl reductase [NADPH] 1(CBR1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Horse Serum amyloid A protein(SAA1)
Express system: E.coli
Species: Equus caballus (Horse)
Recombinant Human Diacylglycerol kinase alpha(DGKA)
Express system: E.coli
Species: Homo sapiens (Human)