Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
pHC379; UDP glucose diphosphorylase; UDP glucose pyrophosphorylase 1; UDP glucose pyrophosphorylase 2; UDP glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDPG; UDPGP 2; UDPGP; UDPGP2; UGP 1; UGP 2; UGP1; Ugp2; UGPA_HUMAN; UGPase 2; UGPase; UGPP 1; UGPP 2; UGPP1; UGPP2; Uridyl diphosphate glucose pyrophosphorylase 1; Uridyl diphosphate glucose pyrophosphorylase 2; UTP glucose 1 phosphate uridyltransferase; UTP glucose 1 phosphate uridylyltransferase 2; UTP glucose 1 phosphate uridylyltransferase; UTP--glucose-1-phosphate uridylyltransferase
Species
Homo sapiens (Human)
Expression Region
1-497aa
Target Protein Sequence
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Human UGP2 covers amino acids 1-497. The calculated molecular weight for this UGP2 protein is 71.7 kDa. Expression of this UGP2 protein is conducted in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the UGP2 encoding gene fragment was conducted, allowing for easier detection and purification of the UGP2 protein in subsequent stages.
Human UTP-Glucose-1-Phosphate Uridylyltransferase (UGP2) is a key enzyme in glycogen metabolism, catalyzing the formation of UDP-glucose. UGP2 plays a vital role in glucose homeostasis, contributing to glycogen synthesis and storage. In metabolic research, UGP2 is crucial for understanding carbohydrate metabolism and its dysregulation in diseases like diabetes. Furthermore, UGP2's involvement in nucleotide sugar biosynthesis makes it relevant in glycosylation pathways, impacting cell signaling and immune responses. Studying UGP2 provides insights into its roles in diverse cellular processes, offering potential applications in metabolic disorders, glycosylation-related diseases, and therapeutic strategies targeting glycogen metabolism and related pathways.
