Recombinant Human UTP--glucose-1-phosphate uridylyltransferase (UGP2)

In Stock
Code CSB-EP620986HU
Abbreviation Recombinant Human UGP2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
UGP2
Uniprot No.
Research Area
Cancer
Alternative Names
pHC379; UDP glucose diphosphorylase; UDP glucose pyrophosphorylase 1; UDP glucose pyrophosphorylase 2; UDP glucose pyrophosphorylase; UDP-glucose pyrophosphorylase; UDPG; UDPGP 2; UDPGP; UDPGP2; UGP 1; UGP 2; UGP1; Ugp2; UGPA_HUMAN; UGPase 2; UGPase; UGPP 1; UGPP 2; UGPP1; UGPP2; Uridyl diphosphate glucose pyrophosphorylase 1; Uridyl diphosphate glucose pyrophosphorylase 2; UTP glucose 1 phosphate uridyltransferase; UTP glucose 1 phosphate uridylyltransferase 2; UTP glucose 1 phosphate uridylyltransferase; UTP--glucose-1-phosphate uridylyltransferase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-497aa
Target Protein Sequence
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
71.7kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human UGP2 covers amino acids 1-497. The calculated molecular weight for this UGP2 protein is 71.7 kDa. Expression of this UGP2 protein is conducted in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the UGP2 encoding gene fragment was conducted, allowing for easier detection and purification of the UGP2 protein in subsequent stages.

Human UTP-Glucose-1-Phosphate Uridylyltransferase (UGP2) is a key enzyme in glycogen metabolism, catalyzing the formation of UDP-glucose. UGP2 plays a vital role in glucose homeostasis, contributing to glycogen synthesis and storage. In metabolic research, UGP2 is crucial for understanding carbohydrate metabolism and its dysregulation in diseases like diabetes. Furthermore, UGP2's involvement in nucleotide sugar biosynthesis makes it relevant in glycosylation pathways, impacting cell signaling and immune responses. Studying UGP2 provides insights into its roles in diverse cellular processes, offering potential applications in metabolic disorders, glycosylation-related diseases, and therapeutic strategies targeting glycogen metabolism and related pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
UTP--glucose-1-phosphate uridylyltransferase catalyzing the conversion of glucose-1-phosphate into UDP-glucose, a crucial precursor for the production of glycogen.
Gene References into Functions
  1. High UGP2 expression is associated with malignant pancreatic lesions. PMID: 29347944
  2. This study provides clear evidence that the octameric state is a prerequisite for activity in the uridine diphosphate-glucose pyrophosphorylase. PMID: 23254995
  3. The crystal structure was determined and shown to form octamers through end-to-end and side-by-side interactions. Mutagenesis studies showed that both dissociation of octamers and mutations of the latch loop can significantly affect the activity. PMID: 22132858
  4. GYS1 regulation by HIF plays a central role in the hypoxic accumulation of glycogen, and hypoxia also upregulates the expression of UTP:glucose-1-phosphate urydylyltransferase (UGP2) and 1,4-alpha glucan branching enzyme (GBE1) PMID: 20300197
Subcellular Location
Cytoplasm.
Protein Families
UDPGP type 1 family
Tissue Specificity
Highly expressed in various brain regions. Expressed in amygdala, anterior cingulate cortex, caudate, cerebellar hemisphere, cerebellum, cortex, frontal cortex, hippocampus, hypothalamus, nucleus accumbens, putamen, spinal cord and substantia nigra. Also
Database Links

HGNC: 12527

OMIM: 191750

KEGG: hsa:7360

STRING: 9606.ENSP00000338703

UniGene: Hs.516217

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*