Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Deubiquitinating enzyme 7; HAUSP; Herpes virus associated ubiquitin specific protease; Herpesvirus-associated ubiquitin-specific protease; TEF 1; tef-1; TEF1; Ubiquitin carboxyl terminal hydrolase 7; Ubiquitin carboxyl-terminal hydrolase 7; Ubiquitin specific peptidase 7 (herpes virus associated); Ubiquitin specific peptidase 7; Ubiquitin specific peptidase 7 herpes virus associated; Ubiquitin specific processing protease 7; Ubiquitin specific protease 7 (herpes virus associated); Ubiquitin specific protease 7; Ubiquitin specific protease 7 herpes virus associated; Ubiquitin thioesterase 7; Ubiquitin thiolesterase 7; Ubiquitin-specific-processing protease 7; UBP 7; UBP-7; UBP7; UBP7_HUMAN; USP 7; usp-7; Usp7; VMW110-ASSOCIATED PROTEIN, 135-KD
Species
Homo sapiens (Human)
Expression Region
214-521aa
Target Protein Sequence
VGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human USP7 was expressed with the amino acid range of 214-521. The expected molecular weight for the USP7 protein is calculated to be 55.6 kDa. Expression of this USP7 protein is conducted in e.coli. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was fused into the coding gene segment of USP7, making it easier to detect and purify the USP7 recombinant protein in the later stages of expression and purification.
Human ubiquitin carboxyl-terminal hydrolase 7 (USP7) plays a pivotal role in cellular homeostasis by regulating the ubiquitin-proteasome system. Its main function involves deubiquitinating target proteins, stabilizing them, and preventing proteasomal degradation. In cell biology and molecular research, studying USP7 provides insights into cellular processes, including DNA repair, apoptosis, and cell cycle progression. USP7's involvement in cancer and neurodegenerative disorders positions it as a potential therapeutic target in oncology and neurobiology research. Investigating USP7 spans diverse research areas, contributing to the understanding of protein regulation, and cellular functions, and offering potential applications in drug discovery and the development of targeted therapies for various diseases.