Recombinant Human Ubiquitin-conjugating enzyme E2 Q2 (UBE2Q2)

Code CSB-EP845153HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
UBE2Q2
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
LOC92912; UB2Q2_HUMAN; UBE2Q2; Ubiquitin carrier protein Q2; Ubiquitin conjugating enzyme E2Q 2; Ubiquitin conjugating enzyme E2Q family member 2; Ubiquitin-conjugating enzyme E2 Q2; ubiquitin-conjugating enzyme E2Q (putative) 2; Ubiquitin-protein ligase Q2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-375aa
Target Protein Sequence
MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
58.8kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination.
Gene References into Functions
  1. UBE2Q1 hypomethylation is associated with Colorectal Cancer. PMID: 26745068
  2. The newly characterized human gene, UBE2Q2, may have implications for the pathogenesis of acute lymphoblastic leukemia. PMID: 22642244
  3. In the 21 breast cancer cases investigated, a high increase in UBE2Q2 expression was found in 8 breast cancers (38.1%), a moderately increased UBE2Q2 expression was observed in 7 cases (33.3%), and no sig. changes were detected in 6 cases (28.6%). PMID: 20193842
  4. Found high expression levels of UBE2Q2 in human head and neck carcinoma cell lines and cancer tissues; found the level of UBE2Q2 is decreased in cell lines and cancer tissues that have resistance to CDDP or docetaxel. PMID: 19723876
  5. the novel LOC92912 gene is characterized. It is over-expressed in hypopharyngeal tumours. Its functions may be linked with the cytoskeleton; it may represent a new target for cancer therapeutics. PMID: 16300736
  6. Inhibition of the UBE2Q2 protein causes cells to undergo a prolonged prophase arrest suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. PMID: 17471241

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Ubiquitin-conjugating enzyme family
Tissue Specificity
Detected in hypopharyngeal head and neck squamous cell carcinoma, in tumor masses and invasive epithelium.
Database Links

HGNC: 19248

OMIM: 612501

KEGG: hsa:92912

STRING: 9606.ENSP00000267938

UniGene: Hs.23033

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*