Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial

Code CSB-YP025488HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025488HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025488HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP025488HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP025488HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Ubiquitin-protein ligase E3A; EC 2.3.2.26; E6AP ubiquitin-protein ligase; HECT-type ubiquitin transferase E3A; Human papillomavirus E6-associated protein; Oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; UBE3A E6AP EPVE6AP HPVE6A
Species
Homo sapiens (Human)
Expression Region
776-875
Target Protein Sequence
YDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the ARNTL/BMAL1, ARC, RAD23A and RAD23B, MCM7 (which is involved in DNA replication), annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B. Additionally, may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. Finally, UBE3A also promotes its own degradation in vivo. Plays an important role in the regulation of the circadian clock: involved in the ubiquitination of the core clock component ARNTL/BMAL1, leading to its proteasomal degradation. Acts as transcriptional coactivator of progesterone receptor PGR upon progesterone hormone activation. Acts as a regulator of synaptic development by mediating ubiquitination and degradation of ARC. Synergizes with WBP2 in enhancing PGR activity.; (Microbial infection) Catalyzes the high-risk human papilloma virus E6-mediated ubiquitination of p53/TP53, contributing to the neoplastic progression of cells infected by these viruses.
Gene References into Functions
  1. UBE3A regulates an imprinted gene network involving DNA methylation and H2A.Z deposition. PMID: 28925810
  2. ANCR overexpression inhibited NSCLC cell migration and invasion and downregulated TGF-beta1 expression, while TGF-beta1 treatment showed no significant effects on ANCR expression but promoted NSCLC cell migration and invasion. PMID: 30154397
  3. Results from a study on gene expression variability markers in early-stage human embryos shows that UBE3A is a putative expression variability marker for the 3-day, 8-cell embryo stage. PMID: 26288249
  4. The divergence of E6 proteins from either MAML1 or E6AP binding preference is a major event in papillomavirus evolution. PMID: 29281732
  5. Data report the establishment and thorough characterization of a new iPSC line from a patient with Angelman syndrome, harboring a defined three-base pair deletion within the maternally inherited UBE3A allele. Using computer modeling of the mutant protein, a local destabilization around the catalytic cleft of UBE3A was proposed, likely impairing the binding of substrates. PMID: 27484051
  6. We demonstrate that E6AP regulates p27 expression by inhibiting its transcription in an E2F1-dependent manner. Concomitant knockdown of E6AP and p27 partially restores PC cell growth, supporting the contribution of p27 to the overall effect of E6AP on prostate tumorigenesis. PMID: 28477016
  7. novel IVS15-1G>C and c.2540 C>T mutations of the UBE3A gene probably underlie the AS in the two families PMID: 29188609
  8. Findings show neuronal overexpression of Ube3a isoform 2 causes phenotypes translatable to neurodevelopmental disorders. PMID: 29016856
  9. This study demonstrate the importance of the N-terminal domain of full length E6AP for diubiquitin chain specificity. PMID: 29288669
  10. our data demonstrates that E6AP facilitates ubiquitination and subsequent degradation of G-CSFR leading to attenuation of its downstream signaling and inhibition of granulocytic differentiation. PMID: 28578910
  11. Novel intragenic deletions within the UBE3A gene have been reported in two unrelated patients with Angelman syndrome. PMID: 29162042
  12. Data suggest ordered binding of UBCH7-ubiquitin to E6AP Site 1 (for E6AP-Cys820/ubiquitin thioester formation) and E6AP Site 2 (for subsequent chain elongation); proximal indexation accounts for symmetric structure of E6AP, requirement for oligomerization in polyubiquitin chain formation, and mechanistic rationale for Cys820-ubiquitin thioester as platform in chain assembly. (UBCH7 = ubiquitin-conjugating enzyme UBCH7) PMID: 28924046
  13. E6AP (UBE3A) abundance is down-regulated in a proportion of NSCLC (non-small cell lung cancer) patients, and this correlates with low p16INK4a in tumors and worse overall survival. PMID: 28074012
  14. study has broad implications for human disorders associated with UBE3A gain or loss of function and suggests that dysfunctional UBE3A might affect additional proteins and pathways that are sensitive to proteasome activity PMID: 28559284
  15. We found that KD of E6AP attenuates cancer cell growth by promoting cellular senescence in vivo, which correlates with restoration of tumor suppression by PML. PMID: 27641331
  16. HCV core protein inhibits E6AP expression via DNA methylation to protect itself from ubiquitin-dependent proteasomal degradation and stimulate virus propagation. PMID: 27317649
  17. E6AP suppresses breast cancer metastasis by regulating actin cytoskeleton remodeling through the control of ECT2 and Rho GTPase activity. PMID: 27231202
  18. Dube3a is neither imprinted nor preferentially expressed from the maternal allele in fly neurons. PMID: 27599063
  19. The ubiquitylation of beta-catenin by E6AP was dependent on its E3 ubiquitin ligase activity, but it was proteasome-independent and did not require HPV16-E6. PMID: 27902311
  20. All patients with Angelman syndrome based on a deletion had epilepsy. Epilepsy was present in 3/4 children with UBE3A mutation. Laughter-induced postural muscle tone loss occurred only among deletion cases PMID: 27323320
  21. The results of Trans-well and cell scratch tests showed that when ANCR expression was decreased, the invasion and migration abilities of SW620 cells significantly declined (both P < 0.05). In conclusion, these results suggest that lncRNA-ANCR could influence the invasion and migration of CRC cells by specifically binding to EZH2. PMID: 27983539
  22. There were total 55 molecularly confirmed Angelman syndrome(AS) between January 1995 to September 2015 for review. 65.5% of them were caused by maternal microdeletion, 10.9% by paternal uniparental disomy, 3.6% by imprinting center defect and 14.5% by UBE3A gene mutation PMID: 27174604
  23. The observation of Dup15q syndrome in individuals with maternally but not paternally inherited duplications of chromosome 15q11-q13, suggest that UBE3A drives the Angelman syndrome phenotype in this disorder. (Review) PMID: 26585570
  24. our results indicate that CSN6 is a positive regulator of E6AP and is important for cervical cancer development. PMID: 26318036
  25. Stable over-expression of E6-AP increases the proliferation and invasion of prostate tumor cells. PMID: 26261538
  26. Impairments in both synaptic plasticity and fear conditioning memory in UBE3A-deficient mice are significantly ameliorated by blocking SK2. These results elucidate a mechanism by which UBE3A directly influences cognitive function. PMID: 26166566
  27. Study describes an upstream regulatory mechanism for UBE3A and provides a comprehensive understanding of how missense mutations linked to Angelman syndrome and autism affect UBE3A protein function. PMID: 26255772
  28. The miR-375-UBE3A axis is important in modulating radiosensitivity of HR-HPV (+) cervical cancer. PMID: 26224081
  29. UBE3A dampens ERK pathway signalling in HPV E6 transformed HeLa cells PMID: 25815718
  30. crystal structure of a ternary complex comprising full-length human papilloma virus type 16 (HPV-16) E6, the LxxLL motif of E6AP and the core domain of p53 PMID: 26789255
  31. UBE3A may regulate the expression of annexin A2, resulting in promotion of proliferation and invasion and suppression of apoptosis in breast cancer cells. PMID: 25816213
  32. The activity of E6AP is controlled by noncovalent interactions with ubiquitin and allosteric activators such as the HPV E6 oncoprotein. PMID: 26216987
  33. E6-AP Lys(847) is required for the formation of Lys(48)-linked polyubiquitin chains. PMID: 26161728
  34. Mutated catalytically inactive forms of UBE3A may cause defects in overall proteasome function. PMID: 25633294
  35. Semirhythmic myoclonus is common in patients with Angelman syndrome caused by UBE3A mutations, and such myoclonic events are often life disabling PMID: 24796722
  36. study identifies E6AP and PML as potential prognostic markers in localized prostate carcinoma and supports a role for E6AP in driving the downregulation or loss of PML expression in prostate carcinomas PMID: 25231954
  37. 111 (4.41%) probands had a nucleotide change classified as pathogenic or strongly favored to be pathogenic, 29 (1.15%) had a VUS, and 126 (5.0%) had a UBE3A nucleotide change classified as benign or strongly favored to be benign PMID: 25212744
  38. Identification of 50 proteins in the Drosophila brain that respond to changes in expression levels of the Drosophila ortholog of UBE3A, Dube3a, in neurons. Some of these genes responded at the transcription level. PMID: 23626758
  39. Since maternal interstitial duplications result in ASD but paternals do not consistently cause ASD this study implicates the maternally expressed UBE3A gene as the driving force behind the ASD phenotype in 15q Duplication syndrome. PMID: 23495136
  40. This study identified E6AP as a novel regulator of the Wnt signaling pathway, capable of cooperating with E6 in stimulating or augmenting Wnt/beta-catenin signaling, thereby possibly contributing to HPV carcinogenesis. PMID: 25262469
  41. Within all subgroups, expressive language performance was significantly reduced when compared to the receptive performance. PMID: 24656292
  42. The data suggest that UBE3A imprinting in neurons only requires UBE3A-ATS expression, and no other neuron-specific factors. PMID: 24363065
  43. In this review, a role for E6AP is defined in the pathobiology of neuro-developmental and neuro-aging diseases. PMID: 24091829
  44. The results of this study indicate the efficiency of the data integration and the significant interrelation between Ube3a and p53 in myocardial cells during apoptosis. PMID: 24337433
  45. DAta indicate that E6-associated protein (E6AP)/UBE3A oligomerization is required for polyubiquitin degradation signal assembly and that changes in oligomerization regulates such activity. PMID: 24273172
  46. pro-IL-1beta is degraded in a proteasome-dependent manner in E6-positive cells which is mediated via the ubiquitin ligase E6-AP and p53. PMID: 23935506
  47. This study screening UBE3A was performed in 43 patients who were referred for Angelman Syndrome but whom previous molecular diagnostic tests failed to provide a diagnosis. PMID: 23416059
  48. E6AP targeted C/EBPalpha protein degradation may provide a possible explanation for both loss of expression and/or functional inactivation of C/EBPalpha in myeloid leukemia. PMID: 23598402
  49. E6AP is an important regulator of ROS-mediated cellular senescence and cell death. PMID: 22986523
  50. Arc protein levels are controlled by E6AP at the transcriptional rather than at the posttranslational level. PMID: 23671107

Show More

Hide All

Involvement in disease
Angelman syndrome (AS)
Subcellular Location
Cytoplasm. Nucleus.
Database Links

HGNC: 12496

OMIM: 105830

KEGG: hsa:7337

STRING: 9606.ENSP00000381045

UniGene: Hs.598862

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1