Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
32 kDa accessory protein; ATP6D; ATP6DV; ATP6V0D1; ATPase H+ transporting lysosomal (vacuolar proton pump) member D; ATPase H+ transporting lysosomal 38kD V0 subunit d; ATPase H+ transporting lysosomal 38kDa V0 subunit d1; ATPase H+ transporting lysosomal V0 subunit d1; H(+) transporting two sector ATPase subunit D; p39; V ATPase 40 KDa accessory protein; V ATPase AC39 subunit; V ATPase subunit d 1; V ATPase subunit D; V-ATPase 40 kDa accessory protein; V-ATPase AC39 subunit; V-ATPase subunit d 1; V-type proton ATPase subunit d 1; VA0D1_HUMAN; Vacuolar ATP synthase subunit d 1; Vacuolar proton pump subunit d 1; VATX; VMA 6; VMA6; VPATPD
Species
Homo sapiens (Human)
Expression Region
1-351aa
Target Protein Sequence
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human ATP6V0D1 contains amino acids 1-351. The theoretical molecular weight of the ATP6V0D1 protein is 67.3 kDa. This ATP6V0D1 recombinant protein is manufactured in e.coli. The N-terminal GST tag was fused into the coding gene segment of ATP6V0D1, making it easier to detect and purify the ATP6V0D1 recombinant protein in the later stages of expression and purification.
Researchers are actively exploring the functions of V-type proton ATPase subunit d 1 (ATP6V0D1). This protein is involved in the formation of the intracellular V-type ATPase complex, crucial for regulating the cellular pH balance. In cancer research, scientists have found a connection between ATP6V0D1 and tumor growth and invasion, suggesting it as a potential target for anti-cancer treatments. Additionally, in the field of neuroscience, ATP6V0D1 is closely associated with synaptic transmission in neurons and membrane transport processes, playing a significant role in the normal functioning of the nervous system. Recent studies have also identified its regulatory role in immune cells, providing a new perspective for research in immunology and autoimmune diseases.