Recombinant Human V-type proton ATPase subunit d 1(ATP6V0D1)

Code CSB-EP002390HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P61421
Relevance Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 32 kDa accessory protein V-ATPase 40 kDa accessory protein V-ATPase AC39 subunit
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Research Area Signal Transduction
Source E.coli
Gene Names ATP6V0D1
Protein Names Recommended name: V-type proton ATPase subunit d 1 Short name= V-ATPase subunit d 1 Alternative name(s): 32 kDa accessory protein V-ATPase 40 kDa accessory protein V-ATPase AC39 subunit Short name= p39 Vacuolar proton pum
Expression Region 1-351aa
Tag Info N-terminal GST-tagged
Mol. Weight 67.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis (By similarity). May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium (By similarity). In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation
Subcellular Location Membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families V-ATPase V0D/AC39 subunit family
Tissue Specificity Ubiquitous.
Database Links

HGNC: 13724

OMIM: 607028

KEGG: hsa:9114

STRING: 9606.ENSP00000290949

UniGene: Hs.106876

Pathway Oxidative Phosphorylation
Synaptic vesicle cycle

Related Products

ATP6V0D1 Antibodies

ATP6V0D1 Antibodies for Homo sapiens (Human)

ATP6V0D1 Antibodies for Human

ATP6V0D1 Proteins

ATP6V0D1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.