Recombinant Human V-type proton ATPase subunit d 1 (ATP6V0D1)

In Stock
Code CSB-EP002390HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ATP6V0D1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
32 kDa accessory protein; ATP6D; ATP6DV; ATP6V0D1; ATPase H+ transporting lysosomal (vacuolar proton pump) member D; ATPase H+ transporting lysosomal 38kD V0 subunit d; ATPase H+ transporting lysosomal 38kDa V0 subunit d1; ATPase H+ transporting lysosomal V0 subunit d1; H(+) transporting two sector ATPase subunit D; p39; V ATPase 40 KDa accessory protein; V ATPase AC39 subunit; V ATPase subunit d 1; V ATPase subunit D; V-ATPase 40 kDa accessory protein; V-ATPase AC39 subunit; V-ATPase subunit d 1; V-type proton ATPase subunit d 1; VA0D1_HUMAN; Vacuolar ATP synthase subunit d 1; Vacuolar proton pump subunit d 1; VATX; VMA 6; VMA6; VPATPD
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-351aa
Target Protein Sequence
MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
67.3kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human ATP6V0D1 contains amino acids 1-351. The theoretical molecular weight of the ATP6V0D1 protein is 67.3 kDa. This ATP6V0D1 recombinant protein is manufactured in e.coli. The N-terminal GST tag was fused into the coding gene segment of ATP6V0D1, making it easier to detect and purify the ATP6V0D1 recombinant protein in the later stages of expression and purification.

Researchers are actively exploring the functions of V-type proton ATPase subunit d 1 (ATP6V0D1). This protein is involved in the formation of the intracellular V-type ATPase complex, crucial for regulating the cellular pH balance. In cancer research, scientists have found a connection between ATP6V0D1 and tumor growth and invasion, suggesting it as a potential target for anti-cancer treatments. Additionally, in the field of neuroscience, ATP6V0D1 is closely associated with synaptic transmission in neurons and membrane transport processes, playing a significant role in the normal functioning of the nervous system. Recent studies have also identified its regulatory role in immune cells, providing a new perspective for research in immunology and autoimmune diseases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Subunit of the integral membrane V0 complex of the lysosomal proton-transporting V-type ATPase (v-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation. May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium.
Gene References into Functions
  1. The secondary structures of d1 and d2 subunits were highly similar, but the relative stability against thermal stress was higher for d1 than d2. PMID: 24631925
  2. two adjacent enhancers inside the first intron of the neighboring (1.4 kb downstream) ATPase gene (ATP6V0D1) modulate the human AgRP promoter with profound spatiotemporal variation PMID: 19285986
  3. Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia PMID: 19165527
Subcellular Location
Membrane; Peripheral membrane protein; Cytoplasmic side. Lysosome membrane.
Protein Families
V-ATPase V0D/AC39 subunit family
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 13724

OMIM: 607028

KEGG: hsa:9114

STRING: 9606.ENSP00000290949

UniGene: Hs.106876

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*