Recombinant Human Tubulinyl-Tyr carboxypeptidase 1 (VASH1)

In Stock
Code CSB-EP745337HU
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
VASH1
Uniprot No.
Research Area
Cardiovascular
Alternative Names
KIAA1036; VASH; VASH1; VASH1_HUMAN; Vasohibin 1; Vasohibin-1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-204aa
Target Protein Sequence
MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
27.3 kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human VASH1 contains amino acids 1-204. The theoretical molecular weight of the VASH1 protein is 27.3 kDa. This VASH1 protein is produced using e.coli expression system. Fusion of the N-terminal 6xHis tag into the VASH1 encoding gene fragment was conducted, allowing for easier detection and purification of the VASH1 protein in subsequent stages.

Human tubulinyl-Tyr carboxypeptidase 1 (VASH1) is a protein involved in angiogenesis and microtubule dynamics. VASH1 mainly functions to regulate microtubule assembly and disassembly, impacting cellular processes like cell migration and division. Investigating VASH1 provides insights into microtubule regulation, angiogenesis, and cellular processes, offering potential applications in cancer therapy, vascular disorders, and neurobiology. In vascular biology, VASH1 influences angiogenesis by modulating endothelial cell behavior. In cancer research, VASH1's role in angiogenesis makes it relevant for tumor growth and metastasis studies, with potential applications in anti-angiogenic therapies. Additionally, VASH1 is implicated in neuronal development.

Citations

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Immunohistochemical staining

Review: Immunohistochemical staining showed a higher expression level of VASH1 in the gingiva of mice with ligature throughout the periodontal tissues, compared with that in control group.

By Anonymous

Target Background

Function
Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function. Critical for spindle function and accurate chromosome segregation during mitosis since microtuble detyronisation regulates mitotic spindle length and postioning. Acts as an angiogenesis inhibitor: inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts.
Gene References into Functions
  1. Low VASH1 expression is associated with angiogenesis and tumor growth in renal cell carcinoma. PMID: 28656230
  2. VASH1 is a prognostic marker in ovarian carcinoma. PMID: 29057763
  3. VASH1 and VASH2 but not SVBP alone, increased detyrosination of -tubulin, and purified vasohibins removed the C-terminal tyrosine of -tubulin. PMID: 29146869
  4. High serum prolactin and vasoinhibin levels predict and may impact retinopathy of prematurity progression PMID: 27842054
  5. Studied angiogenic activity of vasohibin-1 (VASH1), by analyzing levels of VASH1 in both RCC tissue and non-neoplastic kidney tissue. Found elevated VASH1 density, but not microvascular density, was a significant and independent predictor of overall survival in RCC. PMID: 28287633
  6. identified a novel UPS regulatory system in which essential domain architecture (VASH-PS) of VASHs, comprising regions VASH191-180 and VASH280-169 , regulate the cytosolic punctate structure formation in the absence of SVBP. PMID: 27879017
  7. replicative senescence, the downregulation of VASH1 expression in endothelial cells was caused, at least in part, by the alteration of microRNA expression. PMID: 27325558
  8. VASH1 expression is associated with tumour progression and may be useful as a prognostic marker of head and neck squamous cell carcinoma PMID: 28314285
  9. VASH1 expression inhibited tumor vascularization and growth, not only in high VEGF-producing cells, but also in high PDGF-producing cells, reduced their peritoneal dissemination and ascites, and prolonged the survival time of the host PMID: 26893100
  10. in this study, the length of tube forming structures of endothelial cells in vitro showed that Vasohibin-1 expression in gastric cancer cells significantly decreased the ability of vessel formation of endothelium cells. PMID: 26666821
  11. These results indicate that cancer cells proteolytically inactivate VASH1 protein secreted by ECs in the tumour microenvironment PMID: 27169581
  12. Our present findings on VASH1A and VASH1B should provide an innovative approach that would improve the efficacy of antiangiogenic cancer therapy by balancing vascular normalization and pruning. PMID: 27080222
  13. VASH1 exerts an antitumor effect on ovarian cancer by inhibiting angiogenesis in the tumor environment PMID: 26460696
  14. VASH1 expression levels in atheroma reflects both enhanced neovascularization and the inflammatory burden PMID: 25843115
  15. Knockdown of VASH1 in cancer cells promoted cell growth, adhesion and migration in vitro, and enhanced tumorigenesis and metastasis in vivo. PMID: 25797264
  16. VASH1 and VASH2 showed distinctive localization and opposing function on the fetoplacental vascularization. PMID: 25184477
  17. These results suggest that the renal levels of VASH-1 may be affected by local inflammation, crescentic lesions and VEGFR-2. PMID: 25145408
  18. High VASH1 expression is associated with non-small cell lung cancer. PMID: 24748406
  19. Overexpression of VASH1 in CRC cells increased malignant potential and promoted metastasis. PMID: 25275025
  20. We found that vasohibin-1 and VEGF are up-regulated, in mesentery and liver, in cirrhotic and precirrhotic portal hypertensive rats and cirrhosis patients. PMID: 24390792
  21. High Vasohibin-1 expression is associated with colorectal cancer. PMID: 24366689
  22. Vasohibin 1/CD34 could identify the proliferative vessels and could be a useful biomarker for predicting the clinical outcome of hepatocellular carcinoma patients. PMID: 24444468
  23. Data show expression of TGF-beta1, TGF-beta2, BMP-4, and BMP-7 was increased in tumor-associated macrophages (TAMs) cocultured with pancreatic cancer cells, and vasohibin-1, VEGF-A, and vVEGF-C expression in pancreatic cancer cells was upregulated by TAMs. PMID: 23651239
  24. Vasohibin-1 is a new predictor of disease-free survival in operated patients with renal cell carcinoma. PMID: 23543668
  25. Vasohibin-1 and VEGF-A are the most important factors influencing the dismal prognosis based on the modulation of angiogenesis in hepatocellular carcinoma (HCC). PMID: 22101788
  26. vasohibin-1 and vasohibin-2 mRNA are expressed in gastric cancer cells and in tumor-associated macrophages (TAMs), and their expressions are altered by hypoxia. PMID: 22438034
  27. VASH1 density represents a clinically relevant predictor of patient prognosis and can be a new biomarker that would provide additional prognostic information in prostate cancer. PMID: 23591203
  28. we postulate that VASH1 would potentially be a biomarker and a candidate for molecular targeted therapy for patients with renal cell carcinoma PMID: 22865127
  29. novel candidate master regulator of endothelial cell apoptosis PMID: 23324451
  30. VASH1 is a critical factor that improves the stress tolerance of ECs via the induction of SOD2 and SIRT1 PMID: 23056314
  31. Data suggest that VASH1 is expressed in vascular endothelium to terminate angiogenesis; VASH2 appears to be expressed in other cells (primarily mononuclear leukocytes) to promote angiogenesis. [REVIEW] PMID: 23100270
  32. Results suggest that Vasohibin-1 (VASH1)density could become a new biomarker and provide additional prognostic information in patients with upper urinary tract urothelial carcinomas (UTUC). PMID: 22675166
  33. Transgene expression of VASH1 in the recipient lung significantly attenuated luminal obliteration of the tracheal allograft and significantly reduced aberrant angiogenesis. PMID: 22564651
  34. Data suggest that vasohibin inhibits cell proliferation of umbilical vein endothelial cells through degradation of HIF-1alpha via proline hydroxylase during oxidative stress. Vasohibin may be a negative feedback regulator of angiogenesis. PMID: 22569265
  35. Reduced vasohibin and VEGF expression may be responsible, at least in part, for the impaired vascular development which occurs during pre-eclampsia. PMID: 21302448
  36. SVBP(CCDC23)acts as a secretory chaperone for VASH1. PMID: 20736312
  37. vasohibin1 is the first known intrinsic factor having broad-spectrum antilymphangiogenic activity PMID: 20133819
  38. This review focuses on negative regulators of angiogenesis delta-like 4 and vasohibin 1 produced by endothelial cells. PMID: 20167561
  39. These results suggest that vasohibin-1 is expressed in RA synovial tissue and might be regulated by inflammatory cytokines. PMID: 20035291
  40. Results suggest that KIAA1036, or vasohibin, is an endothelium-derived negative feedback regulator of angiogenesis [vasohibin] PMID: 15467828
  41. Recombinant amino-terminal truncated forms of vasohibin retain inhibitory activity of angiogenesis in mouse corneal assay and show strong affinity to heparin. PMID: 16488400
  42. vasohibin has an activity to prevent neointimal formation by inhibiting adventitial angiogenesis PMID: 16707096
  43. expression of vasohibin in the stromal endothelial cells in human carcinomas. PMID: 18325046
  44. vasohibin-1 is associated with neovascularization and may especially play important roles in the regulation of intratumoral angiogenesis in human breast cancer. PMID: 19037993
  45. Hypoxia induces VEGF, which induces the production of vasohibin-1 in endothelial cells and inhibits angiogenesis as a negative feedback regulator. PMID: 19057892
  46. These results suggest a role for VASH1 in negative feedback regulation of haematopoietic progenitors proliferation during recovery following bone marrow ablation. PMID: 19179360
  47. These results suggest that endogenous vasohibin-1 is involved in tumor angiogenesis and exogenous vasohibin-1 blocks sprouting angiogenesis by tumors, matures the remaining vessels, and enhances the antitumor effect of conventional chemotherapy PMID: 19498005
  48. Streptozotocin- induced type 1 diabetic mice received intravenous injections of adenoviral vectors encoding VASH-1, which suppressed diabetic retinopathy. PMID: 19587360
  49. Overexpression of human VASH1 inhibited angiogenic sprouting and supports vascular maturation processes in vivo. PMID: 19682397

Show More

Hide All

Subcellular Location
Cytoplasm. Secreted.
Protein Families
Vasohibin family
Tissue Specificity
Preferentially expressed in endothelial cells. Highly expressed in fetal organs. Expressed in brain and placenta, and at lower level in heart and kidney. Highly detected in microvessels endothelial cells of atherosclerotic lesions.
Database Links

HGNC: 19964

OMIM: 609011

KEGG: hsa:22846

STRING: 9606.ENSP00000167106

UniGene: Hs.525479

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*