Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
KIAA1036; VASH; VASH1; VASH1_HUMAN; Vasohibin 1; Vasohibin-1
Species
Homo sapiens (Human)
Expression Region
1-204aa
Target Protein Sequence
MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human VASH1 contains amino acids 1-204. The theoretical molecular weight of the VASH1 protein is 27.3 kDa. This VASH1 protein is produced using e.coli expression system. Fusion of the N-terminal 6xHis tag into the VASH1 encoding gene fragment was conducted, allowing for easier detection and purification of the VASH1 protein in subsequent stages.
Human tubulinyl-Tyr carboxypeptidase 1 (VASH1) is a protein involved in angiogenesis and microtubule dynamics. VASH1 mainly functions to regulate microtubule assembly and disassembly, impacting cellular processes like cell migration and division. Investigating VASH1 provides insights into microtubule regulation, angiogenesis, and cellular processes, offering potential applications in cancer therapy, vascular disorders, and neurobiology. In vascular biology, VASH1 influences angiogenesis by modulating endothelial cell behavior. In cancer research, VASH1's role in angiogenesis makes it relevant for tumor growth and metastasis studies, with potential applications in anti-angiogenic therapies. Additionally, VASH1 is implicated in neuronal development.