Recombinant Human Vesicle-associated membrane protein-associated protein A (VAPA), partial

In Stock
Code CSB-YP878947HU
Abbreviation Recombinant Human VAPA protein, partial
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
VAMP-A;VAMP-associated protein A;VAP-A;33 kDa VAMP-associated protein;VAP-33
Source
Yeast
Expression Region
2-227aa
Target Protein Sequence
ASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to OSBPL3, which mediates recruitment of VAPA to plasma membrane sites. The ORP3-VAPA complex stimulates RRAS signaling which in turn attenuates integrin beta-1 (ITGB1) activation at the cell surface. With OSBPL3, may regulate ER morphology. May play a role in vesicle trafficking.
Gene References into Functions
  1. The effects of sterol manipulation of HuH7 cells on complexes of established sterol-binding Oxysterol-binding protein related proteins with their endoplasmic reticulum receptor, VAMP-associated protein A (VAPA), were examined. PMID: 25681634
  2. phosphorylation of ORP3 controls its association with VAPA. Furthermore, ORP3-VAPA complexes stimulate R-Ras signaling. PMID: 25447204
  3. GPS2 is required for the association of viral NS5A with VAP-A and hepatitis C virus replication. PMID: 24223774
  4. STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the endoplasmic reticulum. PMID: 24105263
  5. phosphorylation of CERT at the FFAT motif-adjacent serine affects its affinity for VAP, which may regulate the inter-organelle trafficking of ceramide in response to the perturbation of cellular sphingomyelin and/or other sphingolipids PMID: 24569996
  6. Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein VAP-33. PMID: 21957124
  7. Data show that the methylated VAPA-APCDD1 DNA in maternal plasma is predominantly derived from the fetus, and this novel fetal epigenetic marker in maternal plasma is useful for the noninvasive detection of fetal trisomy 18. PMID: 21152411
  8. Electrostatic interaction between oxysterol-binding protein and VAMP-associated protein A revealed by NMR and mutagenesis studies. PMID: 20178991
  9. protein-protein interactions among the various HCV NS proteins and hVAP-33 are important for the formation of HCV replication complex PMID: 15016871
  10. Our results provide suggestive evidence of an association between SNPs in the 3'UTR of the VAPA gene and bipolar disorder. PMID: 18665321
  11. VAP-A is an important regulator both of the subcellular localization of protrudin and of its ability to stimulate neurite outgrowth. PMID: 19289470
  12. GLTP and VAP-A were shown to interact. PMID: 19665998

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Cell membrane; Single-pass type IV membrane protein. Cell junction, tight junction. Nucleus membrane.
Protein Families
VAMP-associated protein (VAP) (TC 9.B.17) family
Tissue Specificity
Ubiquitous.
Database Links

HGNC: 12648

OMIM: 605703

KEGG: hsa:9218

UniGene: Hs.165195

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*