Recombinant Human Vitronectin (VTN)

Code CSB-EP025944HU
Abbreviation Recombinant Human VTN protein
MSDS
Size $422
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
S-protein (Serum-spreading factor) (V75)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
20-478aa
Target Protein Sequence
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human VTN protein is produced by inserting the VTN gene fragment (20-478aa) into a plasmid vector, followed by introducing the recombinant vectors into E.coli cells. Once expressed, the VTN protein is subjected to multiple purification processes involving affinity chromatography. Following purification, SDS-PAGE is employed to check the protein's purity, exceeding 85%.

Human vitronectin (VTN) is a multifunctional glycoprotein that plays a crucial role in various biological processes, including cell adhesion, migration, and the regulation of the immune response. It is predominantly synthesized in the liver and is found in the extracellular matrix (ECM) as well as in plasma [1][2]. Vitronectin is primarily involved in cell adhesion through its interaction with integrins, particularly the αvβ3 and αvβ5 integrins, via its Arg-Gly-Asp (RGD) domain [3][4][5]. This adhesive property is critical for various physiological processes, including wound healing, tissue repair, and the metastatic spread of cancer cells [6][7]. In the context of cancer, altered vitronectin levels have been associated with different stages of tumor progression, suggesting its potential as a biomarker for certain malignancies, including breast and ovarian cancers [6][7][8].

Moreover, vitronectin is implicated in regulating the complement system, particularly in inhibiting the formation of the membrane attack complex (MAC), which is essential for protecting host cells from lysis by the immune system [9]. This function is particularly relevant in bacterial infections, where pathogens such as Neisseria meningitidis and Yersinia pestis exploit vitronectin to enhance their adhesion to host cells and evade immune responses [1][5].

References:
[1] C. Cunha, N. Griffiths, & M. Virji. Neisseria meningitidis opc invasin binds to the sulphated tyrosines of activated vitronectin to attach to and invade human brain endothelial cells, Plos Pathogens, vol. 6, no. 5, p. e1000911, 2010. https://doi.org/10.1371/journal.ppat.1000911
[2] C. Park, M. Song, S. Kim, & B. Min. Vitronectin-derived peptide promotes reparative dentin formation, Journal of Dental Research, vol. 101, no. 12, p. 1481-1489, 2022. https://doi.org/10.1177/00220345221101506
[3] A. Zhou. Functional structure of the somatomedin b domain of vitronectin, Protein Science, vol. 16, no. 7, p. 1502-1508, 2007. https://doi.org/10.1110/ps.072819107
[4] A. Attia, S. Ram, P. Rice, & E. Hansen. Binding of vitronectin by themoraxella catarrhalisuspa2 protein interferes with late stages of the complement cascade, Infection and Immunity, vol. 74, no. 3, p. 1597-1611, 2006. https://doi.org/10.1128/iai.74.3.1597-1611.2006
[5] S. Bartra, Y. Ding, .et al. Yersinia pestis uses the ail outer membrane protein to recruit vitronectin, Microbiology, vol. 161, no. 11, p. 2174-2183, 2015. https://doi.org/10.1099/mic.0.000179
[6] A. Bera, M. Subramanian, et al. Functional role of vitronectin in breast cancer, Plos One, vol. 15, no. 11, p. e0242141, 2020. https://doi.org/10.1371/journal.pone.0242141
[7] G. Schneider, M. Suszynska, S. Kakar, & M. Ratajczak. Vitronectin in the ascites of human ovarian carcinoma acts as a potent chemoattractant for ovarian carcinoma: implication for metastasis by cancer stem cells, Journal of Cancer Stem Cell Research, vol. 4, no. 5, p. 1, 2016. https://doi.org/10.14343/jcscr.2016.4e1005
[8] J. Leroy-Dudal, L. Heyman, P. Gauduchon, & F. Carreiras. Adhesion of human ovarian adenocarcinoma igrov1 cells to endothelial cells is partly mediated by the αv integrins–vitronectin adhesive system and induces an alteration of endothelial integrity, Cell Biology International, vol. 29, no. 6, p. 482-488, 2005. https://doi.org/10.1016/j.cellbi.2005.01.008
[9] L. Carreras-Planella, D. Cucchiari, et al. Urinary vitronectin identifies patients with high levels of fibrosis in kidney grafts, Journal of Nephrology, vol. 34, no. 3, p. 861-874, 2020. https://doi.org/10.1007/s40620-020-00886-y

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.; Somatomedin-B is a growth hormone-dependent serum factor with protease-inhibiting activity.
Gene References into Functions
  1. Insulin resistance and age independently predicted VTN levels. VTN may be a candidate target for the appraisal of hepatic insulin resistance in patients with type 2 diabetes. PMID: 29780059
  2. The 10 kDa C-terminal fragment of the ECM protein vitronectin (VTN) was then selected as a promising circulating biomarker in discriminating Nonalcoholic steatohepatitis. PMID: 29463024
  3. The authors observed that exposure of Burkholderia pseudomallei and the closely related yet avirulent Burkholderia thailandensis to human plasma increased epithelial cell invasion by >20 fold. Receptor blocking studies with RGD-domain containing peptide and alphaV beta3 blocking antibody identified complement-activated vitronectin as the factor facilitating this invasion. PMID: 28186697
  4. Additionally, the authors utilized vitroenctin-derived peptides to map the minimal Rickettsia conorii Adr1/human vitronectin interaction to the C-terminal region of vitronectin. PMID: 28299286
  5. We show that small N-terminal fragments of VN consistent with processing of the RGD motif are present in liquid biopsies of cancer patients as well as in the urine of healthy individuals. PMID: 27189837
  6. Serum vitronectin levels are elevated in human glioma, as well as are independently associated with pathologic grade based on WHO classification and 5-year poor prognosis. Moreover, this biomarker significantly discriminates gliomas from controls, other non-glioma brain tumors and other non-tumor neurological diseases, distinguishes high-grade gliomas from low-grade gliomas, and predicts 5-year progression and mortality. PMID: 27871448
  7. Elevated serum VN levels represented high diagnostic value and had close relation to clinicopathological factors and early recurrence, suggesting that serum VN might be a useful diagnostic and prognostic marker for HCC. PMID: 27802203
  8. We confirmed increased levels of C1R and VTN in sera from patients with Joint hypermobility syndrome by western blot analyses PMID: 26709396
  9. This study examines the complexes of PAI-1 with tissue-type and urokinase-type plasminogen activator and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop. PMID: 26548921
  10. Ail-expressing Yersinia pestis strains bind vitronectin - a host protein with functions in cell attachment, fibrinolysis and inhibition of the complement system. PMID: 26377177
  11. High expression of VN in tumor cells independently indicated poor clinical prognosis in patients with osteosarcoma. PMID: 26617861
  12. The mean level of PAI-1 was 23.02 +/- 15 (8.2-71.19) ng/mL and vitronectin was 83.10% +/- 23.77% (12%-126%) in the tumor group. PMID: 24770328
  13. Bacterial protein-E and host vitronectin play a role in the attachment to bronchial epithelial cells and is also involved in the subsequent intracellular invasion of nontypeable Haemophilus influenzae. PMID: 26572616
  14. P. aeruginosa isolates obtained from CF patients significantly bound vitronectin. Porin D was defined as a novel P. aeruginosa vitronectin-receptor PMID: 26047937
  15. Lpd of P. aeruginosa is a surface exposed moonlighting protein that binds two human terminal pathway inhibitors, vitronectin and clusterin PMID: 26368530
  16. The VN level may be relevant as a clinical biomarker for adverse cardiovascular outcomes not only in patients with ischemic heart disease undergoing coronary interventions. PMID: 24823429
  17. Vitronectin expression in the airways of subjects with asthma and chronic obstructive pulmonary disease PMID: 25768308
  18. Gpm1 in Candida albicans attaches to human endothelial cells and to keratinocytes via the adhesive protein vitronectin PMID: 24625558
  19. Vitronectin is identified as a common constituent of amyloid deposits in 175 formalin-fixed and paraffin-embedded tissue samples from a large variety of different amyloid diseases. PMID: 26101327
  20. Hic interacts with vitronectin and simultaneously with Factor H, and both human proteins may contribute to colonisation and invasive disease caused by serotype 3 pneumococci. PMID: 25181963
  21. VTN plays a significant role in the malignant growth of tumor. PMID: 25179307
  22. Melanoma cell adhesion to vitronectin is dependent on beta-1,6-branched N-glycans. PMID: 24687613
  23. A total of 17 site-specific N-glycopeptides were completely identified in all of the three N-glycosylation sites of vitronectin in human plasma, including 12 N-glycopeptides first reported. PMID: 25374123
  24. The presence of VN on the material surfaces enhanced cell-mediated FN reorganization and secretion. PMID: 23899674
  25. serum levels of both fibronectin and vitronectin may be the diagnostic markers in melanoma patients, but not markers of prognosis PMID: 24999757
  26. Authors demonstrate that an evolutionarily conserved rickettsial antigen, Adr1/RC1281, interacts with human vitronectin and is sufficient to mediate resistance to serum killing when expressed at the outer-membrane. PMID: 24286496
  27. The interaction between uPAR and vitronectin triggers ligand-independent adhesion signalling by integrins. PMID: 25168639
  28. A strong linkage disequilibrium was found in vitronectin promoter in Chinese with vascular disease. PMID: 23041018
  29. Vn competes with hTSP-1 for binding to Atl repeats and vice versa. In conclusion, this study identifies the Atl repeats as bacterial adhesive structures interacting with the human glycoproteins hTSP-1 and Vn. PMID: 24371140
  30. increased expression levels of VN protein and mRNA in placental maternal-fetal interface of EOSP may be involved in adhesion and repair of placental infarct lesions. PMID: 23124223
  31. Interaction of vitronectin with integrin alphavbeta3 results in the continued activation of the kinase mTOR. PMID: 23722547
  32. In conclusion, the head domains of UspA2/2H have extensive sequence polymorphism without losing vitronectin-binding capacity promoting a general evasion of the host immune system. PMID: 23474333
  33. study highlights that ascites-derived fibronectin and vitronectin exhibit different properties depending on the ascites PMID: 23811340
  34. An isogenic nontypeable Haemophilus influenzae 3655Deltahpf mutant devoid of protein F displayed a reduced binding of vitronectin, and was consequently more sensitive to killing by human serum compared with the wild type. PMID: 23387957
  35. The choline-binding protein PspC of Streptococcus pneumoniae interacts with the C-terminal heparin-binding domain of vitronectin. PMID: 23603906
  36. Importance of vitronectin and its interaction with the urokinase receptor in tumor growth. PMID: 23327926
  37. There was no difference in serum vitronectin levels between Behcet's disease patients and control subjects, and there was no statistically significant difference between vitronectin levels in Behcet patients with and without ocular involvement. PMID: 22810367
  38. In this study, the authors demonstrate meningococcal interactions with vitronectin via a novel adhesin, Msf (meningococcal surface fibril, previously NhhA or Hsf). PMID: 22050461
  39. higgh plasms levels is associated with the risk of metabolic syndrome and type 2 diabetes mellitus PMID: 21800006
  40. A series of truncated vitronectin molecules revealed that the C-terminal domain comprising vitronectin(353-363) harboured the major binding region for Haemophilus influenzae protein E. PMID: 21542857
  41. High serum vitronectin is associated with breast cancer. PMID: 21253761
  42. PAI-2 is capable of inhibiting uPA in the presence of PAI-1, particularly on adherent cells in the presence of vitronectin PMID: 21316840
  43. Thrombospondin 1, fibronectin, and vitronectin are differentially dependent upon RAS, ERK1/2, and p38 for induction of vascular smooth muscle cell chemotaxis. PMID: 21193465
  44. The results provide the first evidence for vitronectin gene expression in urothelial cells. PMID: 21048021
  45. Plasminogen activator inhibitor-1 and vitronectin expression level and stoichiometry regulate vascular smooth muscle cell migration through physiological collagen matrices PMID: 20492459
  46. expression of vitronectin at the periphery of mesothelial cells and within ovarian cancer cell clusters suggests a potential role for this molecule during intraperitoneal implantation of ovarian cancer cells PMID: 20121701
  47. This study directly reveals the binding mode between the N-terminal domain of UspA2 Moraxella catarrhalis and the C-terminal part of vitronectin and thus sheds light upon the mechanism of Moraxella catarrhalis-dependent serum resistance. PMID: 20199596
  48. Data reveal that multimeric VTNC attenuate Cyr61 binding to immobilized VTNC, while monomeric VTNC was ineffective. PMID: 20195466
  49. A fragment of vitronectin containing the RGD integrin binding site showed similar binding affinity as that of full vitronectin protein to purified integrin alphavbeta3 but had diminished cell adhesion and spreading function in vivo. PMID: 20600001
  50. Neisseria meningitidis Opc expressed in acapsulate as well as capsulate bacteria can increase human brain endothelial cell line adhesion and entry by first binding to serum vitronectin PMID: 20502634

Show More

Hide All

Subcellular Location
Secreted, extracellular space.; Parasitophorous vacuole.
Tissue Specificity
Expressed in the retina pigment epithelium (at protein level). Expressed in plasma (at protein level). Expressed in serum (at protein level).
Database Links

HGNC: 12724

OMIM: 193190

KEGG: hsa:7448

STRING: 9606.ENSP00000226218

UniGene: Hs.2257

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*