Recombinant Human Xaa-Pro aminopeptidase 1 (XPNPEP1)

In Stock
Code CSB-EP878859HU
Abbreviation Recombinant Human XPNPEP1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
XPNPEP1
Uniprot No.
Research Area
Metabolism
Alternative Names
Aminoacylproline aminopeptidase; aminopeptidase P, cytosolic; APP1; Cytosolic aminopeptidase P; RP11 451M19.1; sAmp; Soluble aminopeptidase P; soluble; X Pro aminopeptidase 1; X prolyl aminopeptidase (aminopeptidase P) 1; X prolyl aminopeptidase (Aminopeptidase P) 1 soluble; X prolyl aminopeptidase 1; X prolyl aminopeptidase 1 soluble; X-Pro aminopeptidase 1; X-prolyl aminopeptidase 1; Xaa Pro aminopeptidase 1; Xaa-Pro aminopeptidase 1; XPNPEP 1; XPNPEP; xpnpep1; XPNPEPL; XPNPEPL1; XPP1_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-623aa
Target Protein Sequence
PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
85.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human XPNPEP1 covers amino acids 2-623. This XPNPEP1 protein is expected to have a theoretical molecular weight of 85.8 kDa. The XPNPEP1 protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of XPNPEP1, making it easier to detect and purify the XPNPEP1 recombinant protein in the later stages of expression and purification.

Human Xaa-Pro aminopeptidase 1 (XPNPEP1), also known as aminopeptidase P, belongs to the M1 family of metallopeptidases. XPNPEP1 primarily functions in the hydrolysis of amino-terminal amino acid residues from peptides, particularly those with Xaa-Pro or Xaa-Ala sequences. It plays a role in the regulation of bioactive peptides and has been implicated in various physiological processes, including blood pressure regulation and sodium homeostasis. XPNPEP1 is expressed in tissues such as the kidney, where it participates in the degradation of peptides involved in these processes. Understanding XPNPEP1's functions contributes to insights into peptide metabolism and its potential implications for human health.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.
Gene References into Functions
  1. Alanine replacement of Arg535 destabilizes the AMPP dimer and guanidine hydrochloride restores the native monomer-dimer equilibrium. It is proposed that Arg535 plays an important role in AMMP catalysis and in stabilization of the catalytically active dimeric state PMID: 29351301
  2. These data suggest that progesterone-induced increases in AP-P may contribute to the development of oral contraceptive pill-induced hypertension in susceptible Women. PMID: 19126663
Subcellular Location
Cytoplasm.
Protein Families
Peptidase M24B family
Tissue Specificity
Expressed in all tissues tested, including pancreas, heart, muscle, kidney, liver, lung and brain. Highest levels in pancreas.
Database Links

HGNC: 12822

OMIM: 602443

KEGG: hsa:7511

STRING: 9606.ENSP00000421566

UniGene: Hs.390623

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*