Recombinant Human YTH domain-containing family protein 1 (YTHDF1)

In Stock
Code CSB-YP874843HU
Abbreviation Recombinant Human YTHDF1 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
C20orf21; DACA 1; DACA-1; Dermatomyositis associated with cancer putative autoantigen 1; YTH domain family 1; YTH domain family member 1; YTH domain family protein 1; YTHD1; YTHD1_HUMAN; Ythdf1
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
2-559aa
Target Protein Sequence
SATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The mature human YTHDF1 protein-encoding gene (2-559aa) is tagged at the N-terminus with a 6xHis sequence to produce the target gene. This gene undergoes PCR amplification and is then inserted into expression vectors for recombinant plasmid construction. These plasmids are transfected into yeast cells, which are induced for protein expression in culture. The culture supernatant is harvested and purified using affinity chromatography, obtaining the recombinant human YTHDF1 protein with a purity level above 85%, verified by SDS-PAGE.

The YTHDF1 protein is a critical reader of N6-methyladenosine (m6A) modifications on mRNA, playing a significant role in the regulation of gene expression, particularly in the context of cancer biology. YTHDF1 is primarily located in the cytoplasm and is known to facilitate the translation of m6A-modified mRNAs, thereby influencing various cellular processes including proliferation, differentiation, and tumorigenesis [1][2][3].

YTHDF1 operates by binding to m6A sites on mRNA, which enhances the translation efficiency of these transcripts. This function is particularly important in cancer, where YTHDF1 has been shown to promote the expression of oncogenes and facilitate processes such as epithelial-mesenchymal transition (EMT), a key event in cancer metastasis [4][5][3]. Studies have demonstrated that YTHDF1 enhances the translation of specific mRNAs such as ARHGEF2 and YAP, which are involved in RhoA signaling and drug resistance, respectively [2][6]. Furthermore, YTHDF1's interaction with the translation machinery, including components like eIF4G and eIF3, underscores its role in cap-dependent translation initiation [7].

YTHDF1 has also been implicated in the degradation of mRNA, suggesting a dual role in both promoting and regulating mRNA stability [8]. This regulatory capacity is essential for maintaining cellular homeostasis and responding to environmental cues, such as hypoxia, which can influence YTHDF1 expression and activity [9]. Moreover, YTHDF1 has been linked to immune evasion in tumors, as it can promote the degradation of MHC-I molecules, thereby reducing the immune system's ability to recognize and attack cancer cells [3].

References:
[1] Y. Bao, J. Zhai, H. Chen, C. Wong, C. Liang, Y. Dinget al., Targeting m6a reader ythdf1 augments antitumour immunity and boosts anti-pd-1 efficacy in colorectal cancer, Gut, vol. 72, no. 8, p. 1497-1509, 2023. https://doi.org/10.1136/gutjnl-2022-328845
[2] S. Wang, S. Gao, Y. Zeng, L. Zhu, Y. Mo, C. Wonget al., N6-methyladenosine reader ythdf1 promotes arhgef2 translation and rhoa signaling in colorectal cancer, Gastroenterology, vol. 162, no. 4, p. 1183-1196, 2022. https://doi.org/10.1053/j.gastro.2021.12.269
[3] W. Lin, L. Chen, H. Zhang, X. Qiu, Q. Huang, F. Wanet al., Tumor-intrinsic ythdf1 drives immune evasion and resistance to immune checkpoint inhibitors via promoting mhc-i degradation, Nature Communications, vol. 14, no. 1, 2023. https://doi.org/10.1038/s41467-022-35710-7
[4] Y. Bai, C. Yang, R. Wu, L. Huang, S. Song, W. Liet al., Ythdf1 regulates tumorigenicity and cancer stem cell-like activity in human colorectal carcinoma, Frontiers in Oncology, vol. 9, 2019. https://doi.org/10.3389/fonc.2019.00332
[5] X. Luo, M. Cao, F. Gao, & X. He, Ythdf1 promotes hepatocellular carcinoma progression via activating pi3k/akt/mtor signaling pathway and inducing epithelial-mesenchymal transition, Experimental Hematology and Oncology, vol. 10, no. 1, 2021. https://doi.org/10.1186/s40164-021-00227-0
[6] J. Xing, Y. He, K. Wang, P. Wan, & X. Zhai, Involvement of ythdf1 in renal fibrosis progression via up‐regulating yap, The Faseb Journal, vol. 36, no. 2, 2022. https://doi.org/10.1096/fj.202100172rr
[7] B. Shi, W. Liu, K. Yang, G. Jiang, & H. Wang, The role, mechanism, and application of rna methyltransferase mettl14 in gastrointestinal cancer, Molecular Cancer, vol. 21, no. 1, 2022. https://doi.org/10.1186/s12943-022-01634-5
[8] J. Li, K. Chen, X. Dong, Y. Xu, Q. Sun, H. Wanget al., Ythdf1 promotes mrna degradation via ythdf1‐ago2 interaction and phase separation, Cell Proliferation, vol. 55, no. 1, 2021. https://doi.org/10.1111/cpr.13157
[9] Y. Shi, S. Fan, M. Wu, Z. Zuo, X. Li, L. Jianget al., Ythdf1 links hypoxia adaptation and non-small cell lung cancer progression, Nature Communications, vol. 10, no. 1, 2019. https://doi.org/10.1038/s41467-019-12801-6

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and regulates their stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in mRNA stability and processing. Acts as a regulator of mRNA stability by promoting degradation of m6A-containing mRNAs via interaction with the CCR4-NOT complex. The YTHDF paralogs (YTHDF1, YTHDF2 and YTHDF3) shares m6A-containing mRNAs targets and act redundantly to mediate mRNA degradation and cellular differentiation. Required to facilitate learning and memory formation in the hippocampus by binding to m6A-containing neuronal mRNAs. Acts as a regulator of axon guidance by binding to m6A-containing ROBO3 transcripts. Acts as a negative regulator of antigen cross-presentation in myeloid dendritic cells. In the context of tumorigenesis, negative regulation of antigen cross-presentation limits the anti-tumor response by reducing efficiency of tumor-antigen cross-presentation. Promotes formation of phase-separated membraneless compartments, such as P-bodies or stress granules, by undergoing liquid-liquid phase separation upon binding to mRNAs containing multiple m6A-modified residues: polymethylated mRNAs act as a multivalent scaffold for the binding of YTHDF proteins, juxtaposing their disordered regions and thereby leading to phase separation. The resulting mRNA-YTHDF complexes then partition into different endogenous phase-separated membraneless compartments, such as P-bodies, stress granules or neuronal RNA granules.
Gene References into Functions
  1. YTHDF1 played an important role in regulating hepatocellular carcinoma cell cycle progression and metabolism PMID: 29439311
  2. The authors found that the overexpression of YTHDF proteins in cells inhibited HIV-1 infection mainly by decreasing HIV-1 reverse transcription, while knockdown of YTHDF1-3 in cells had the opposite effects. Moreover, silencing the N(6)-methyladenosine writers decreased HIV-1 Gag protein expression in virus-producing cells, while silencing the N(6)-methyladenosine erasers increased Gag expression. PMID: 27371828
  3. binding affinities of the YTH domains of three human proteins and yeast YTH domain protein Pho92 PMID: 26318451
Subcellular Location
Cytoplasm. Cytoplasm, P-body. Cytoplasm, Stress granule.
Database Links

HGNC: 15867

OMIM: 616529

KEGG: hsa:54915

STRING: 9606.ENSP00000359364

UniGene: Hs.744852

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*