Recombinant Human YTH domain-containing family protein 1 (YTHDF1)

In Stock Promotion
Code CSB-EP874843HU
Abbreviation Recombinant Human YTHDF1 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
C20orf21; DACA 1; DACA-1; Dermatomyositis associated with cancer putative autoantigen 1; YTH domain family 1; YTH domain family member 1; YTH domain family protein 1; YTHD1; YTHD1_HUMAN; Ythdf1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-559aa
Target Protein Sequence
SATSVDTQRTKGQDNKVQNGSLHQKDTVHDNDFEPYLTGQSNQSNSYPSMSDPYLSSYYPPSIGFPYSLNEAPWSTAGDPPIPYLTTYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQPGFHSDTLSKAPGMNSLEQGMVGLKIGDVSSSAVKTVGSVVSSVALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
66.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

YTHDF1, a member of the YTH domain family, is an m6A reader protein that plays a crucial role in various cancers, including non-small cell lung cancer (NSCLC), colorectal carcinoma, hepatocellular carcinoma, and gastric tumors. It has been found to promote tumor progression, metastasis, and cancer stem cell-like activity [1][2]. YTHDF1 is involved in regulating mRNA stability and facilitating translation initiation by interacting with initiation factors and ribosomes [3][4]. Additionally, it has been linked to the activation of the PI3K/AKT/mTOR signaling pathway and the induction of epithelial-mesenchymal transition in hepatocellular carcinoma [2]. Furthermore, YTHDF1 has been associated with better patient survival and an inflamed tumor-immune microenvironment in NSCLC, indicating its potential as a prognostic biomarker [3][5]. Studies have also suggested that YTHDF1 may inhibit the growth of neuroblastoma and restore sensitivity to antitumor immunity in gastric tumors [6][7]. Moreover, YTHDF1 has been implicated in promoting cancer progression by regulating ferritin-mediated ferroptosis in lung carcinoma [4]. However, the molecular mechanisms through which YTHDF1 exerts its functions and its regulation remain areas of active research [8][9]. Overall, YTHDF1 emerges as a potential therapeutic target and prognostic biomarker in cancer, with its multifaceted roles in tumorigenesis and tumor progression.

References:
[1] Y. Bai, C. Yang, R. Wu, L. Huang, S. Song, W. Liet al., "Ythdf1 regulates tumorigenicity and cancer stem cell-like activity in human colorectal carcinoma", Frontiers in Oncology, vol. 9, 2019. https://doi.org/10.3389/fonc.2019.00332
[2] X. Luo, M. Cao, F. Gao, & X. He, "Ythdf1 promotes hepatocellular carcinoma progression via activating pi3k/akt/mtor signaling pathway and inducing epithelial-mesenchymal transition", Experimental Hematology and Oncology, vol. 10, no. 1, 2021. https://doi.org/10.1186/s40164-021-00227-0
[3] K. Tsuchiya, K. Yoshimura, Y. Inoue, Y. Iwashita, H. Yamada, A. Kawaseet al., "Ythdf1 and ythdf2 are associated with better patient survival and an inflamed tumor-immune microenvironment in non–small-cell lung cancer", Oncoimmunology, vol. 10, no. 1, 2021. https://doi.org/10.1080/2162402x.2021.1962656
[4] H. Diao, H. Tan, Y. Hu, R. Wang, P. Cai, B. Huanget al., "The m6a reader ythdf1 promotes lung carcinoma progression via regulating ferritin mediate ferroptosis in an m6a-dependent manner", Pharmaceuticals, vol. 16, no. 2, p. 185, 2023. https://doi.org/10.3390/ph16020185
[5] J. Hu, D. Qiu, A. Yu, J. Hu, H. Deng, H. Liet al., "Ythdf1 is a potential pan-cancer biomarker for prognosis and immunotherapy", Frontiers in Oncology, vol. 11, 2021. https://doi.org/10.3389/fonc.2021.607224
[6] J. Deng, J. Long, Y. Yang, & F. Yang, "M6a reader ythdf1 inhibits the growth of neuroblastoma in vitro and in vivo",, 2023. https://doi.org/10.21203/rs.3.rs-3166065/v1
[7] X. Bai, Y. Pan, H. Chen, W. Liu, J. Zhai, W. Kanget al., "Loss of ythdf1 in gastric tumors restores sensitivity to antitumor immunity by recruiting mature dendritic cells", Journal for Immunotherapy of Cancer, vol. 10, no. 2, p. e003663, 2022. https://doi.org/10.1136/jitc-2021-003663
[8] J. Zhou, D. Xiao, T. Qiu, J. Li, & Z. Liu, "Loading microrna-376c in extracellular vesicles inhibits properties of non-small cell lung cancer cells by targeting ythdf1", Technology in Cancer Research & Treatment, vol. 19, p. 153303382097752, 2020. https://doi.org/10.1177/1533033820977525
[9] Y. Shi, S. Fan, M. Wu, Z. Zuo, X. Li, L. Jianget al., "Ythdf1 links hypoxia adaptation and non-small cell lung cancer progression", Nature Communications, vol. 10, no. 1, 2019. https://doi.org/10.1038/s41467-019-12801-6

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Is the protein purity assessed with Coomassie blue gel staining? If yes, could you provide us the detailed insight?
Could you provide any insight for preferable buffer to maintain the protein activity optimally?

A:

We have not tested the activity of this protein for the time being and cannot guarantee 100% activity. The purity is comprehensively evaluated by SDS-PAGE Coomassie blue staining detection and Bandscan software analysis, which can ensure that the purity is above 85%.
For protein reconstitution, it is recommended to centrifuge briefly after receipt and add sterile deionized water to reconstitute. For long-term storage, it is recommended to add 10-50% glycerin and store it at -20°C after aliquoting.

Target Background

Function
Specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and regulates their stability. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in mRNA stability and processing. Acts as a regulator of mRNA stability by promoting degradation of m6A-containing mRNAs via interaction with the CCR4-NOT complex. The YTHDF paralogs (YTHDF1, YTHDF2 and YTHDF3) shares m6A-containing mRNAs targets and act redundantly to mediate mRNA degradation and cellular differentiation. Required to facilitate learning and memory formation in the hippocampus by binding to m6A-containing neuronal mRNAs. Acts as a regulator of axon guidance by binding to m6A-containing ROBO3 transcripts. Acts as a negative regulator of antigen cross-presentation in myeloid dendritic cells. In the context of tumorigenesis, negative regulation of antigen cross-presentation limits the anti-tumor response by reducing efficiency of tumor-antigen cross-presentation. Promotes formation of phase-separated membraneless compartments, such as P-bodies or stress granules, by undergoing liquid-liquid phase separation upon binding to mRNAs containing multiple m6A-modified residues: polymethylated mRNAs act as a multivalent scaffold for the binding of YTHDF proteins, juxtaposing their disordered regions and thereby leading to phase separation. The resulting mRNA-YTHDF complexes then partition into different endogenous phase-separated membraneless compartments, such as P-bodies, stress granules or neuronal RNA granules.
Gene References into Functions
  1. YTHDF1 played an important role in regulating hepatocellular carcinoma cell cycle progression and metabolism PMID: 29439311
  2. The authors found that the overexpression of YTHDF proteins in cells inhibited HIV-1 infection mainly by decreasing HIV-1 reverse transcription, while knockdown of YTHDF1-3 in cells had the opposite effects. Moreover, silencing the N(6)-methyladenosine writers decreased HIV-1 Gag protein expression in virus-producing cells, while silencing the N(6)-methyladenosine erasers increased Gag expression. PMID: 27371828
  3. binding affinities of the YTH domains of three human proteins and yeast YTH domain protein Pho92 PMID: 26318451
Subcellular Location
Cytoplasm. Cytoplasm, P-body. Cytoplasm, Stress granule.
Database Links

HGNC: 15867

OMIM: 616529

KEGG: hsa:54915

STRING: 9606.ENSP00000359364

UniGene: Hs.744852

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*