Recombinant Human cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (PDE10A), partial

Code CSB-YP2272HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP2272HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP2272HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP2272HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP2272HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A; EC 3.1.4.17; PDE10A
Species
Homo sapiens (Human)
Expression Region
718-1035
Target Protein Sequence
TSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGE
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. Can hydrolyze both cAMP and cGMP, but has higher affinity for cAMP and is more efficient with cAMP as substrate. May play a critical role in regulating cAMP and cGMP levels in the striatum, a region of the brain that contributes to the control of movement and cognition.
Gene References into Functions
  1. childhood onset of chorea with normal cognition and striatal hyperintensities should prompt further evaluation beyond benign hereditary chorea and heterozygous or homozygous mutations in PDE10A can cause such a phenotype. More number of cases needs to be identified before a definite phenotype genotype correlation can be made in such cases. PMID: 29130591
  2. Results indicate that aging is associated with a considerable physiological reduction of the availability of phosphodiesterase 10A enzyme enzyme in the striatum. PMID: 28254508
  3. Collectively, these findings highlight a novel thermoregulatory role for PDE10A in mouse and human adipocytes and promote PDE10A inhibitors as promising candidates for the treatment of obesity and diabetes. PMID: 27247380
  4. The method proposed for quantification of [(11)C]Lu AE92686 binding in applied studies in NHP is based on 63 min PET data and SRTM with cerebellum as a reference region. The study supports that [(11)C]Lu AE92686 can be used for PET examinations of PDE10A binding also in substantia nigra. PMID: 27817159
  5. Studied what regions of the PDE10A gene are transcribed in human putamen and caudate nucleus brain tissue, two sub-regions of the striatum. Surprisingly, twelve novel transcripts were detected, of which three were predicted to be translated into PDE10A proteins with unique N-termini.studies show that there is much more transcript diversity within the PDE10A gene region than initially believed. PMID: 28042091
  6. The PDE10A gene is currently known to be comprised of 23 exons26 and maps to chromosome 6q26,17, 18 a region previously associated with bipolar disorder. PMID: 26905414
  7. germline PDE10A mutations associated with hyperkinetic movement disorder PMID: 27058446
  8. We have demonstrated that de novo dominant mutations in PDE10A are the cause of a unique movement disorder characterized by benign childhood-onset chorea and typical MRI abnormalities of the striatum. PMID: 27058447
  9. cGMP PDE isozymes, PDE5 and 10, are elevated in colon tumor cells compared with normal colonocytes, and inhibitors and siRNAs can selectively suppress colon tumor cell growth PMID: 26299804
  10. Longitudinal data in a cohort of patients with early Huntington disease found PDE10 to be a useful biomarker of disease progression. PMID: 26802091
  11. Lu AF33241 represents a novel PDE2A/PDE10A inhibitor tool which can penetrate the blood brain barrier. PMID: 25941078
  12. Data provide evidence that PDE10 is involved in colon tumorigenesis and show its overexpression in colon tumor cells compared with colonocytes. PMID: 24704829
  13. PDE10A activity in medium spiny neurons in Huntington's disease might still be high in critical subcellular compartments, despite the overall striatal PDE10A decrease measured using positron-emission tomography. PMID: 24353339
  14. HPRT-deficiency alters cAMP/PKA signaling pathway, which is in part due to the increased of PDE10A expression and activi PMID: 23691025
  15. The present study is the first to demonstrate a central role of PDE10A in progressive pulmonary vascular remodeling. PMID: 21494592
  16. The data of this results supported a model whereby PDE10A trafficking and localization can be regulated in response to local fluctuations in cAMP levels. PMID: 20610737
  17. analysis of functional chimeras of the phosphodiesterase 5 and 10 tandem GAF domains PMID: 18635550
  18. Binding of cyclic nucleotides to phosphodiesterase 10A and 11A GAF domains does not stimulate catalytic activity. PMID: 19689430

Show More

Hide All

Involvement in disease
Dyskinesia, limb and orofacial, infantile-onset (IOLOD); Striatal degeneration, autosomal dominant 2 (ADSD2)
Subcellular Location
Cytoplasm. Note=Located mostly to soluble cellular fractions.
Protein Families
Cyclic nucleotide phosphodiesterase family
Tissue Specificity
Abundant in the putamen and caudate nucleus regions of brain and testis, moderately expressed in the thyroid gland, pituitary gland, thalamus and cerebellum.
Database Links

HGNC: 8772

OMIM: 610652

KEGG: hsa:10846

STRING: 9606.ENSP00000438284

UniGene: Hs.348762

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1