Recombinant Human tRNA methyltransferase 112 homolog (TRMT112)

In Stock
Code CSB-EP883416HU
Abbreviation Recombinant Human TRMT112 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP883416HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRMT112.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP883416HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRMT112.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
TRMT112
Uniprot No.
Research Area
Metabolism
Alternative Names
TRMT112; AD-001; HSPC152; HSPC170; Multifunctional methyltransferase subunit TRM112-like protein; tRNA methyltransferase 112 homolog
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-125aa
Target Protein Sequence
MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.2kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 1-125 constitute the expression domain of recombinant Human TRMT112. The expected molecular weight for the TRMT112 protein is calculated to be 30.2 kDa. Expression of this TRMT112 protein is conducted in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of TRMT112, making it easier to detect and purify the TRMT112 recombinant protein in the later stages of expression and purification.

The human tRNA methyltransferase 112 homolog (TRMT112) is a protein involved in tRNA modification. TRMT112 is essential for the proper functioning of the tRNA modification machinery. TRMT112 associates with various tRNA methyltransferases, aiding in the methylation of specific nucleotides within tRNAs. This methylation process contributes to the structural stability and accurate translation of mRNA into proteins during protein synthesis. Research on TRMT112 extends to understanding its role in ensuring the fidelity of translation and its potential implications in various cellular processes. Exploring TRMT112 provides valuable insights into the intricate regulatory mechanisms governing protein synthesis and broader cellular functions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as an activator of both rRNA/tRNA and protein methyltransferases. Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA. The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with HEMK2/N6AMT1 also monomethylates 'Lys-12' of histone H4 (H4K12me1). The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species. Involved in the pre-rRNA processing steps leading to small-subunit rRNA production. Together with methyltransferase METTL5, specifically methylates the 6th position of adenine in position 1832 of 18S rRNA.
Gene References into Functions
  1. The localization of the TRMT112 protein is determined by WBSCR22, and the WBSCR22-TRMT112 complex is localized in the cell nucleus. PMID: 26214185
Subcellular Location
Nucleus, nucleoplasm. Cytoplasm, perinuclear region.
Protein Families
TRM112 family
Database Links

HGNC: 26940

KEGG: hsa:51504

STRING: 9606.ENSP00000438349

UniGene: Hs.333579

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*