Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
TRMT112; AD-001; HSPC152; HSPC170; Multifunctional methyltransferase subunit TRM112-like protein; tRNA methyltransferase 112 homolog
Species
Homo sapiens (Human)
Expression Region
1-125aa
Target Protein Sequence
MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-125 constitute the expression domain of recombinant Human TRMT112. The expected molecular weight for the TRMT112 protein is calculated to be 30.2 kDa. Expression of this TRMT112 protein is conducted in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of TRMT112, making it easier to detect and purify the TRMT112 recombinant protein in the later stages of expression and purification.
The human tRNA methyltransferase 112 homolog (TRMT112) is a protein involved in tRNA modification. TRMT112 is essential for the proper functioning of the tRNA modification machinery. TRMT112 associates with various tRNA methyltransferases, aiding in the methylation of specific nucleotides within tRNAs. This methylation process contributes to the structural stability and accurate translation of mRNA into proteins during protein synthesis. Research on TRMT112 extends to understanding its role in ensuring the fidelity of translation and its potential implications in various cellular processes. Exploring TRMT112 provides valuable insights into the intricate regulatory mechanisms governing protein synthesis and broader cellular functions.