Code | CSB-EP510513KBG |
MSDS | |
Size | US$388 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I am looking for NDM-1 protein from E.coli/ Kpn source for measurement of IC50's of small molecule inhibitors on the catalytic activity of the enzyme, using a chromogenic substrate like Nitrocefin/CENTA or Penicillin G.
Please let me know if Recombinant bacterial metallo beta lactamase NDM-1 can be used for catalytic activity measurements. I am confused about the exact expression region of the protein (164-222aa) and the size of the protein (~13-14KDa? or it is ~7KDa?). Please clarify.
GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR
AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG
I am in need of full length NDM-1 from E.coli/Kpn expressed in E.coli, that is enzymatically active.
What is the difference between CSB-EP510513KBG >> E.coli and CSB-EP510513KBGa0 >> E.coli ?
Can you provide references where these proteins are used for in vitro catalytic activity (IC50) measurements (hydrolysis of carbapenems).
KEGG: ag:CAZ39946