Name: Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2 (blaNDM-1)
Brand: CUSABIO
SKU: CSB-EP510513KBG

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

blaNDM-1

Uniprot No.

C7C422

Alternative Names

blaNDM-1Metallo-beta-lactamase type 2; EC 3.5.2.6; B2 metallo-beta-lactamase; Beta-lactamase type II; Metallo-beta-lactamase NDM-1; Metallo-beta-lactamase type II; New Delhi metallo-beta-lactamase-1; NDM-1

Species

Klebsiella pneumoniae

Source

E.coli

Expression Region

29-270aa

Target Protein Sequence

GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

41.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I am looking for NDM-1 protein from E.coli/ Kpn source for measurement of IC50's of small molecule inhibitors on the catalytic activity of the enzyme, using a chromogenic substrate like Nitrocefin/CENTA or Penicillin G.
Please let me know if Recombinant bacterial metallo beta lactamase NDM-1 can be used for catalytic activity measurements. I am confused about the exact expression region of the protein (164-222aa) and the size of the protein (~13-14KDa? or it is ~7KDa?). Please clarify.

Very nice to receive your inquiry. Kpn should refer to Klebsiella pneumoniae, the Cat No you mentioned corresponds to the region of 29-270aa, but later you mentioned the region of 164-222aa.
We can provide both of the two regions, please check the quotation as follows:
Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1)
CSB-EP510513KBG >> E.coli N-terminal 6xHis-SUMO-tagged
CSB-EP510513KBGa0 >> E.coli N-terminal 6xHis-tagged
Expression Region: 29-270aa; Full length of the mature protein.
Sequence:

Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1),partial
CSB-YP510513KBG1 >> Yeast
CSB-EP510513KBG1 >> E.coli
CSB-BP510513KBG1 >> Baculovirus
CSB-MP510513KBG1 >> Mammalian cell
Expression Region: 164-222aa; Partial.
Tag information: Tag type will be determined during the manufacturing process.
Sequence:

AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG

CSB-EP510513KBG1 Expression Region: 164-222aa; The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged
The Mw of the target protein is around 6kDa, and the Mw of the tag is around 5kDa, so the final Mw of the fusion protein is about 11kDa.

I am in need of full length NDM-1 from E.coli/Kpn expressed in E.coli, that is enzymatically active.
What is the difference between CSB-EP510513KBG >> E.coli and CSB-EP510513KBGa0 >> E.coli ?
Can you provide references where these proteins are used for in vitro catalytic activity (IC50) measurements (hydrolysis of carbapenems).

Thanks for your inquiry. The difference between CSB-EP510513KBG >> E.coli and CSB-EP510513KBGa0 >> E.coli is the tag, CSB-EP510513KBG: N-terminal 6xHis-SUMO-tagged; CSB-EP510513KBGa0: N-terminal 6xHis-tagged;
We can provide these proteins, but as we haven't tested the activity, so we can't guarantee it's enzymatically active.
Sorry, there isn't any references where these proteins are used for in vitro catalytic activity (IC50) measurements (hydrolysis of carbapenems).

Target Background

Function

Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.

Subcellular Location

Periplasm.

Protein Families

Metallo-beta-lactamase superfamily, Class-B beta-lactamase family

Database Links

KEGG: ag:CAZ39946

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address