Recombinant Macaca mulatta Erythropoietin(EPO)

Code CSB-MP007743MOW
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. Q28513
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Macaca mulatta (Rhesus macaque)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence APPRLVCDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRIEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR
Research Area Signal Transduction
Source Mammalian cell
Gene Names EPO
Expression Region 28-192aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal 6xHis-tagged
Mol. Weight 22.2kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Subcellular location Secreted
Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage

Related Products

EPO Antibodies

EPO Antibodies for Homo sapiens (Human)

EPO Antibodies for Bos taurus (Bovine)

EPO Antibodies for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

EPO Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

EPO Proteins

EPO Proteins for Ovis aries (Sheep)

EPO Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

EPO Proteins for Felis catus (Cat) (Felis silvestris catus)

EPO Proteins for Bos taurus (Bovine)

EPO Proteins for Sus scrofa (Pig)

EPO Proteins for Mus musculus (Mouse)

EPO Proteins for Bos mutus grunniens (Wild yak) (Bos grunniens)

EPO Proteins for Rattus norvegicus (Rat)

EPO Proteins for Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

EPO Proteins for Epinephelus coioides (Orange-spotted grouper) (Epinephelus nebulosus)

EPO Proteins for Takifugu rubripes (Japanese pufferfish) (Fugu rubripes)

EPO Proteins for Nannospalax galili (Northern Israeli blind subterranean mole rat) (Spalax galili)

EPO Proteins for Spalax carmeli (Southern Israeli blind subterranean mole rat)

EPO Proteins for Spalax golani (Golan Heights blind mole rat) (Nannospalax golani)

EPO Proteins for Spalax judaei (Judean Mountains blind mole rat) (Nannospalax judaei)

EPO Proteins for Equus caballus (Horse)

EPO Proteins for Oryctolagus cuniculus (Rabbit)

EPO Proteins for Microtus oeconomus (Tundra vole)

EPO Proteins for Macaca mulatta (Rhesus macaque)

EPO Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

EPO Proteins for Tetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)

EPO Proteins for Homo sapiens (Human)

EPO cDNA

EPO cDNA for Rattus norvegicus (Rat)

EPO cDNA for Felis catus (Cat) (Felis silvestris catus)

EPO cDNA for Canis lupus familiaris (Dog) (Canis familiaris)

EPO cDNA for Macaca mulatta (Rhesus macaque)

EPO cDNA for Danio rerio (Zebrafish) (Brachydanio rerio)

EPO cDNA for Equus caballus (Horse)

EPO cDNA for Bos taurus (Bovine)

EPO cDNA for Sus scrofa (Pig)

EPO cDNA for Mus musculus (Mouse)

EPO ELISA Kit

EPO ELISA Kit for Bos taurus (Bovine)

EPO ELISA Kit for Canis lupus familiaris (Dog) (Canis familiaris)

EPO ELISA Kit for Equus caballus (Horse)

EPO ELISA Kit for Homo sapiens (Human)

EPO ELISA Kit for Macaca mulatta (Rhesus macaque)

EPO ELISA Kit for Mus musculus (Mouse)

EPO ELISA Kit for Sus scrofa (Pig)

EPO ELISA Kit for Oryctolagus cuniculus (Rabbit)

EPO ELISA Kit for Rattus norvegicus (Rat)

EPO ELISA Kit for Ovis aries (Sheep)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.