Recombinant Mouse Acyl-protein thioesterase 1 (Lypla1)

In Stock
Code CSB-EP013268MO
Abbreviation Recombinant Mouse Lypla1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Lypla1
Uniprot No.
Research Area
Others
Alternative Names
Lypla1; Apt1; Pla1a; Acyl-protein thioesterase 1; APT-1; EC 3.1.2.-; Lysophospholipase 1; Lysophospholipase I; LPL-I; LysoPLA I
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-230aa
Target Protein Sequence
MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.7kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Acyl-protein thioesterase 1 (Lypla1) represents a full-length protein expressed in E. coli, with an N-terminal GST tag that makes purification more straightforward. SDS-PAGE analysis indicates purity levels above 90%, though this protein is intended strictly for research purposes. Scientists may find this a dependable resource for investigating enzyme activity and protein interactions across different experimental conditions.

Acyl-protein thioesterase 1 (Lypla1) appears to play an important role in controlling protein palmitoylation dynamics—a post-translational modification that influences where proteins end up in cells and how they function. This enzyme seems to be connected to multiple cellular processes, particularly signal transduction and membrane trafficking. Understanding how this protein works could be key to grasping how protein interactions and functions get fine-tuned in living systems.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant mouse Lypla1 is expressed in E. coli, a prokaryotic system that may be suitable for this cytosolic enzyme, as it does not require complex post-translational modifications. The protein is full-length (1-230aa) with high purity (>90%), and the GST tag may enhance solubility. However, since activity is unverified, the Lypla1 protein cannot be assumed to be correctly folded or bioactive. Lypla1 requires precise folding of its α/β hydrolase domain for enzymatic activity, and while E. coli can often fold soluble cytosolic proteins; experimental validation is essential.

1. GST Pull-Down Assays for Protein-Protein Interaction Studies

The GST tag enables pull-down experiments to identify potential binding partners. However, if Lypla1 is misfolded, interactions may not be physiological. The high purity reduces background but does not guarantee native conformation. This application should include proper controls and validation of the folding state before biological interpretation.

2. Antibody Development and Validation

This application is appropriate. The recombinant Lypla1 can serve as an effective immunogen for generating antibodies. The full-length sequence ensures broad epitope coverage, and the GST tag facilitates purification. Even if misfolded, antibodies may still recognize linear epitopes useful for techniques such as Western blotting.

3. Biochemical Characterization and Enzyme Kinetics Studies

This application requires validation first. While the Lypla1 protein can be used for biochemical studies, enzyme kinetics assays are only valid if the protein is properly folded and active. Initial studies should focus on verifying thioesterase activity before quantitative kinetic analysis.

4. Comparative Species Analysis

This application is feasible but requires caution. Comparative studies are only meaningful if the recombinant Lypla1 protein is properly folded. If misfolded, species differences may be obscured by folding artifacts. This should be pursued after confirming proper folding and activity.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, recommend first performing functional validation through enzymatic activity assays using known Lypla1 substrates (e.g., palmitoylated peptides). Conduct biophysical characterization (size exclusion chromatography, circular dichroism) to assess folding state. Once activity is confirmed, the recombinant Lypla1 protein can be used for all the described applications. For immediate use, antibody development is the safest application. Always include appropriate controls and validate findings with complementary methods when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a acyl-protein thioesterase hydrolyzing fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Could also depalmitoylate ADRB2. Acts as a lysophospholipase hydrolyzing various lysophospholipids including lysophosphatidylcholine (lyso-PC), lysophosphatidylethanolamine (lyso-PE), lysophosphatidylinositol (lyso-PI) and lysophosphatidylserine (lyso-PS)(PubMed:9139730). Has much higher thioesterase activity than lysophospholipase activity. Contributes to the production of lysophosphatidic acid (LPA) during blood coagulation by recognizing and cleaving plasma phospholipids to generate lysophospholipids which in turn act as substrates for ENPP2 to produce LPA.
Gene References into Functions
  1. Lyplal1 is dispensable for normal mouse metabolic physiology. PMID: 29084768
  2. Data indicate that thioesterases APT1/APT2 depalmitoylate nicotinamide mononucleotide adenylyltransferase 2 (NMNAT2) and zDHHC17 is the strongest candidate palmitoyltransferase for NMNAT2. PMID: 25271157
  3. Dynamic palmitoylation links cytosol-membrane shuttling of acyl-protein thioesterase-1 and acyl-protein thioesterase-2 with that of proto-oncogene H-ras product and growth-associated protein-43 PMID: 23396970
Subcellular Location
Cytoplasm. Cell membrane. Nucleus membrane. Endoplasmic reticulum.
Protein Families
AB hydrolase superfamily, AB hydrolase 2 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*