Recombinant Mouse Adropin (Enho)

In Stock
Code CSB-EP811682MO
Abbreviation Recombinant Mouse Enho protein
MSDS
Size $388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
34-76aa
Target Protein Sequence
CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the regulation of glucose homeostasis and lipid metabolism.
Gene References into Functions
  1. Adropin prevents atherosclerosis development by suppressing monocyte-endothelial cell adhesion and smooth muscle cell proliferation. PMID: 29701665
  2. An inverse correlation between serum adropin levels and mouse age that was attenuated by calorie restriction. PMID: 28922017
  3. our data suggest that adropin is a membrane-bound protein that interacts with the brain-specific Notch1 ligand NB3. PMID: 25074942
  4. these results suggest a role for adropin in regulating muscle substrate preference under various nutritional states. PMID: 24848071
  5. Release of adropin in the fed condition regulates fuel selection in skeletal muscle, promoting glucose oxidation over fat oxidation. The molecular mechanisms of adropin's effects involve acetylation (suggesting inhibition) of the transcriptional co-activator PGC1alpha, reducing PDK4 and CPT1B activity. Increased PGC1alpha acetylation by adropin may be mediated by inhibiting Sirtuin-1 (SIRT1), a PGC1alpha deacetylase. PMID: 24848071
  6. a potential endothelial protective role of adropin that is likely mediated via upregulation of endothelial NO synthase expression through the VEGFR2-phosphatidylinositol 3-kinase-Akt and VEGFR2-extracellular signal regulated kinase 1/2 pathways. PMID: 20837912
  7. Adropin has an endothelial protective function mediated via upregulation of eNOS expression through the VEGFR2-PI3K-Akt and VEGFR2-ERK1/2 pathways. Adropin therapy may thus be useful for limiting diseases characterized by endothelial dysfunction. PMID: 20837912
  8. Adropin regulated expression of hepatic lipogenic genes and adipose tissue peroxisome proliferator-activated receptor gamma, a major regulator of lipogenesis. PMID: 19041763
  9. Adropin is the name given to the secreted peptide encoded by human C9orf165. In mice, it is abundant in liver where it is regulated by dietary macronutrients. Adropin regulates expression of genes involved in lipogenesis and adipogenesis. PMID: 19041763

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Expressed in liver and brain. Expressed in regions of the brain involved in metabolic regulation.
Database Links

KEGG: mmu:69638

UniGene: Mm.372459

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*