Recombinant Mouse Angiogenin-4 (Ang4)

In Stock
Code CSB-YP661010MOa4
Abbreviation Recombinant Mouse Ang4 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Ang4
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Ang4Angiogenin-4; EC 3.1.27.-
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
25-144aa
Target Protein Sequence
QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-sumostar-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Angiogenin-4 (Ang4) is produced in a yeast expression system and contains the full-length mature protein sequence, specifically amino acids 25-144. An N-terminal 6xHis-sumostar tag is included to make purification and detection more straightforward. SDS-PAGE analysis shows the product has greater than 90% purity, which appears to make it suitable for various research applications that need high-quality protein samples.

Angiogenin-4 (Ang4) is a protein that's involved in angiogenesis - the process where new blood vessels form. This process seems crucial in many normal body functions as well as disease states. Ang4 belongs to the ribonuclease A superfamily and likely plays a role in how cells respond to changes in their surrounding environment. Researchers are particularly interested in Ang4 when studying blood vessel development and the signaling pathways that control it.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant mouse Ang4 protein is unlikely to be correctly folded or fully bioactive without experimental validation. Ang4 is a member of the RNase A superfamily and requires precise folding, including disulfide bond formation, for its ribonuclease activity. The yeast expression system may support eukaryotic-like folding and disulfide bonding, but the N-terminal 6xHis-SUMOstar tag is large (approximately 15-20 kDa) compared to the mature Ang4 domain (∼13 kDa, 25-144aa), which could sterically hinder proper folding, particularly near the active site. The tag may disrupt the tertiary structure essential for enzymatic function. Without validation (e.g., circular dichroism for secondary structure, ribonuclease activity assays), the protein's folding and bioactivity remain uncertain. Therefore, while the eukaryotic system offers some advantages, the large tag poses a high risk of misfolding.

This recombinant Ang4 can generate antibodies, but they will primarily target the immunodominant SUMOstar tag rather than Ang4-specific epitopes. If correctly folded, antibodies might recognize native conformations; if misfolded, they may detect non-physiological epitopes, reducing utility for detecting endogenous Ang4. For specific antibodies, remove the tag before immunization or use tag-free protein for validation assays. The high purity minimizes cross-reactivity with contaminants but not with the tag itself.

Given the substantial interference from the large SUMOstar tag, it is critical to first remove the tag using SUMO protease (if the construct includes a cleavage site) and purify the tag-free Ang4 domain. Then, validate folding and bioactivity using techniques such as circular dichroism to confirm expected secondary structure (e.g., alpha-helical content typical of RNase A family), ribonuclease activity assays with synthetic RNA substrates to measure enzymatic function, and size-exclusion chromatography to assess oligomeric state. If tag removal is not feasible, limit applications to tag-centric uses (e.g., anti-SUMOstar antibody development) and avoid functional studies like enzymatic assays or interaction mapping. For all applications, include controls such as tag-free Ang4 or known bioactive standards to account for potential artifacts.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).
Gene References into Functions
  1. Intestinal intraepithelial lymphocyte-enterocyte crosstalk regulates production of bactericidal angiogenin 4 by Paneth cells upon microbial challenge. PMID: 24358364
  2. The cellular source of mouse Ang4 in the colon following T. muris infection is the goblet cell and expression is under the control of IL-13. PMID: 22970115
  3. Expression of Reg3 proteins and Ang4 by goblet cells point to an important role for goblet cells in innate defense. PMID: 22723890
  4. differences in gene expression profiles associated with immune and defence responses, including angiogenin 4 PMID: 19852835
  5. protein structure of angiogenin 4 PMID: 15772759

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, secretory vesicle lumen. Secreted. Nucleus, nucleolus.
Protein Families
Pancreatic ribonuclease family
Tissue Specificity
Detected in small intestine, caecum and colon, with the highest expression in Paneth cells in the intestinal epithelium.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*