Name: Recombinant Mouse Anterior gradient protein 2 homolog(Agr2)
Brand: CUSABIO
SKU: CSB-EP001458MO

Product Details

Purity	Greater than 85% as determined by SDS-PAGE.
Target Names	Agr2
Uniprot No.	O88312
Research Area	Cancer
Alternative Names	Agr2; Gob4Anterior gradient protein 2 homolog; AG-2; mAG-2; Protein Gob-4; Secreted cement gland protein XAG-2 homolog
Species	Mus musculus (Mouse)
Source	E.coli
Expression Region	21-175a
Target Protein Sequence	KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	25.3 kDa
Protein Length	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	13-23 business days
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion.
Gene References into Functions	AGR2 accelerates skin wound healing through regulation of cell migration. PMID: 28665039 AGR2 induced in ER-stressed and inflammatory pre-neoplastic pancreas is a potential marker of cancer progenitor cells with an important functional role in PDAC initiation. PMID: 27941872 impact of AGR2 expression and EGFR signaling on tissue regeneration PMID: 27764193 EGFR-mediated signaling in NCI-H460 cells is disrupted with reduced AGR2 expression. PMID: 25666625 AGR2 has both intracellular and extracellular effects in the intestine PMID: 25111734 Results indicate that DNA methylation within the AGR2 promoter modulates more aggressive cancer cell phenotypes. PMID: 24920423 It was concluded that: the expression of AGR2 protein was significantly higher in asthmatic mice as compared with their normal counterparts; the expression was obviously related to the expression of Muc5ac protein and IL-13. PMID: 23392704 Agr2 consequently serves to maintain the balance between proliferating and differentiated epithelial cells. PMID: 23209296 Agr2 facilitates normal lobuloalveolar development by regulating mammary epithelial cell proliferation; we found no effects on apoptosis in Agr2(-/-) mammary epithelial cells. PMID: 22819674 Loss of Foxp1/4 in the developing lung and in postnatal secretory epithelium leads to ectopic activation of the goblet cell fate program, in part, through de-repression of the protein disulfide isomerase anterior gradient 2 (Agr2). PMID: 22675208 studies implicate Agr2 in intestinal homeostasis and ER stress and suggest a role in the etiology of inflammatory bowel disease PMID: 20025862 AGR2 may be important for the growth and development of the intestine as well as esophageal adenocarcinomas. PMID: 18199544 Overexpression of Agr2 is associated with asthma. PMID: 19028979 AGR2 is a unique member of the protein disulfide isomerase family, with a specialized and nonredundant role in intestinal mucus production PMID: 19359471 Show More Hide All
Subcellular Location	Secreted. Endoplasmic reticulum.
Protein Families	AGR family
Tissue Specificity	Expressed in lung, skeletal muscle, testis, liver, stomach, colon, small intestine, the goblet cells of the intestine and the mucuous neck cells of the stomach.
Database Links	KEGG: mmu:23795 STRING: 10090.ENSMUSP00000020898 UniGene: Mm.7244

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP001458MO
Size	$2466
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Anterior gradient protein 2 homolog(Agr2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage