Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Agr2

Uniprot No.

O88312

Research Area

Cancer

Alternative Names

Agr2; Gob4Anterior gradient protein 2 homolog; AG-2; mAG-2; Protein Gob-4; Secreted cement gland protein XAG-2 homolog

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

21-175a

Target Protein Sequence

KDTTVKSGAKKDPKDSRPKLPQTLSRGWGDQLIWTQTYEEALYRSKTSNRPLMVIHHLDECPHSQALKKVFAEHKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIVFVDPSLTVRADITGRYSNRLYAYEPSDTALLYDNMKKALKLLKTEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.3 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The process for recombinant Mouse Agr2 protein synthesis in e.coli cells includes recombining the DNA fragment that encodes the Mouse Agr2 protein (21-175aa) into expression vector, transforming the recombinant vector into e.coli cells, screening positive cells, cultivating and inducing cells, conducting cell lysis, and performing expression analysis. The resulting recombinant Mouse Agr2 protein is purified from the cell lysate using affinity purification, with its purity exceeding 85% as determined by SDS-PAGE.

Target Background

Function

Required for MUC2 post-transcriptional synthesis and secretion. May play a role in the production of mucus by intestinal cells. Proto-oncogene that may play a role in cell migration, cell differentiation and cell growth. Promotes cell adhesion.

Gene References into Functions

AGR2 accelerates skin wound healing through regulation of cell migration. PMID: 28665039
AGR2 induced in ER-stressed and inflammatory pre-neoplastic pancreas is a potential marker of cancer progenitor cells with an important functional role in PDAC initiation. PMID: 27941872
impact of AGR2 expression and EGFR signaling on tissue regeneration PMID: 27764193
EGFR-mediated signaling in NCI-H460 cells is disrupted with reduced AGR2 expression. PMID: 25666625
AGR2 has both intracellular and extracellular effects in the intestine PMID: 25111734
Results indicate that DNA methylation within the AGR2 promoter modulates more aggressive cancer cell phenotypes. PMID: 24920423
It was concluded that: the expression of AGR2 protein was significantly higher in asthmatic mice as compared with their normal counterparts; the expression was obviously related to the expression of Muc5ac protein and IL-13. PMID: 23392704
Agr2 consequently serves to maintain the balance between proliferating and differentiated epithelial cells. PMID: 23209296
Agr2 facilitates normal lobuloalveolar development by regulating mammary epithelial cell proliferation; we found no effects on apoptosis in Agr2(-/-) mammary epithelial cells. PMID: 22819674
Loss of Foxp1/4 in the developing lung and in postnatal secretory epithelium leads to ectopic activation of the goblet cell fate program, in part, through de-repression of the protein disulfide isomerase anterior gradient 2 (Agr2). PMID: 22675208
studies implicate Agr2 in intestinal homeostasis and ER stress and suggest a role in the etiology of inflammatory bowel disease PMID: 20025862
AGR2 may be important for the growth and development of the intestine as well as esophageal adenocarcinomas. PMID: 18199544
Overexpression of Agr2 is associated with asthma. PMID: 19028979
AGR2 is a unique member of the protein disulfide isomerase family, with a specialized and nonredundant role in intestinal mucus production PMID: 19359471

Hide All

Subcellular Location

Secreted. Endoplasmic reticulum.

Protein Families

AGR family

Tissue Specificity

Expressed in lung, skeletal muscle, testis, liver, stomach, colon, small intestine, the goblet cells of the intestine and the mucuous neck cells of the stomach.

Database Links

KEGG: mmu:23795

STRING: 10090.ENSMUSP00000020898

UniGene: Mm.7244

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP001458MO
Abbreviation	Recombinant Mouse Agr2 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Anterior gradient protein 2 homolog (Agr2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage