Recombinant Mouse Apolipoprotein D (Apod)

In Stock
Code CSB-EP001935MO
Abbreviation Recombinant Mouse Apod protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Apod
Uniprot No.
Research Area
Cancer
Alternative Names
(Apo-D)(ApoD)
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
21-189aa
Target Protein Sequence
QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 21-189 form the expressed segment for recombinant Mouse Apod. This Apod protein is expected to have a theoretical molecular weight of 26.9 kDa. This Apod protein is produced using e.coli expression system. The Apod gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Apod protein during the following stages.

The mouse Apolipoprotein D (ApoD) is a glycoprotein primarily associated with lipoprotein particles in the bloodstream. It is a member of the lipocalin family and is involved in lipid metabolism and transport. ApoD plays a role in protecting cells from oxidative stress, neuroprotection, and modulation of inflammation. It has been linked to various physiological processes, including aging, neurodegenerative disorders, and cancer. In research, ApoD is studied to understand its functions in lipid homeostasis, and neuroprotection, and its potential implications in age-related diseases. Investigating ApoD's diverse roles contributes to our knowledge of lipid biology and its relevance to human health.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
APOD occurs in the macromolecular complex with lecithin-transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.
Gene References into Functions
  1. Study shows that in myelin maturation ApoD ultimately controls the removal of the sialic-rich hydrophilic glycocalyx, by maintaining functional integrity of lysosomes. A detailed analysis of the mechanism reveals that the proper localization of Neu1 and plasma membrane Neu3, as well as of the membrane-bound Fyn kinase, depend on ApoD. PMID: 29222871
  2. apoD protein levels are variable across different brain regions. PMID: 26829325
  3. It regulates amyloid plaque pathology in a mouse model of Alzheimer's disease PMID: 25784209
  4. apoD may be part of an intrinsic cardioprotective system, possibly as a consequence of its antioxidation activity. PMID: 24082102
  5. Changes in hypothalamus of ApoD(-/-) mice may indicate potential role of ApoD in regulation of endocrine functions of somatostatin in a receptor-dependent manner. PMID: 22581439
  6. Abeta25-35 induces neuroprotective ApoD expression in hippocampal cells in response to stress-induced growth arrest. PMID: 22398376
  7. The findings underscore the importance of ApoD in the regulation of plasma insulin levels and triglyceride metabolism, suggesting that ApoD plays an important role in the pathogenesis of dyslipidemia. PMID: 21632073
  8. The data of this study supported that ApoD contributes to the endurance of astrocytes and decreases their reactivity level in vitro and in vivo PMID: 21688324
  9. Scanning cytometry revealed PACAP/ApoD induced low density lipoprotein receptors (LDLR) and ApoE receptor 2 (apoER2) in NF200-positive cells. PMID: 20920539
  10. mRNA and protein expression profiles reveal that ApoD is functionally connected in an age-dependent manner to specific molecular programs triggered by injury. PMID: 20607718
  11. Apolipoprotein D plays a significant role in lipid metabolism. PMID: 20124557
  12. This study concluded that glutamatergic pathways seem to be particularly affected in ApoD(-/-) mice. PMID: 19963028
  13. Expression pattern of the lipocalin apolipoprotein D during mouse embryogenesis. PMID: 11744388
  14. Apolipoprotein D-immunolabeled cells are observed in select grey matter nuclei, including the globus pallidus, thalamus, and substantia nigra, and in white matter tracts within the internal capsule and cerebellum of Neimann-Pick type C mouse brain. PMID: 12815234
  15. apolipoprotein D and the lipogenic protein Spot 14 are LXR alpha and LXRB responsive genes both in vitro and in vivo PMID: 14703507
  16. ApoD messenger RNA expression was localised to the spiral ligament and spiral limbus, particularly in the suprastrial and supralimbral regions. PMID: 15668042
  17. These observations, together with its transcriptional up-regulation in the brain upon oxidative insult, identify ApoD as an acute response protein with a protective and therefore beneficial function mediated by the control of peroxidated lipids. PMID: 18419796
  18. Taken together, our results describe receptor and region specific changes in SST and SSTR subtypes expression in ApoD(-/-) mice brain, which may be linked to specific neurological disorders. PMID: 19465111

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Calycin superfamily, Lipocalin family
Tissue Specificity
Highest levels of expression in brain, testis, virgin mammary gland and salivary gland. Moderate levels in skeletal muscle, lactating mammary gland and thymus. Low levels in lung and lymph node. No expression in kidney, pancreas, liver or spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*