Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Apod

Uniprot No.

P51910

Research Area

Cancer

Alternative Names

(Apo-D)(ApoD)

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

21-189aa

Target Protein Sequence

QNFHLGKCPSPPVQENFDVKKYLGRWYEIEKIPASFEKGNCIQANYSLMENGNIEVLNKELSPDGTMNQVKGEAKQSNVSEPAKLEVQFFPLMPPAPYWILATDYENYALVYSCTTFFWLFHVDFVWILGRNPYLPPETITYLKDILTSNGIDIEKMTTTDQANCPDFL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

26.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 21-189 form the expressed segment for recombinant Mouse Apod. This Apod protein is expected to have a theoretical molecular weight of 26.9 kDa. This Apod protein is produced using e.coli expression system. The Apod gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant Apod protein during the following stages.

The mouse Apolipoprotein D (ApoD) is a glycoprotein primarily associated with lipoprotein particles in the bloodstream. It is a member of the lipocalin family and is involved in lipid metabolism and transport. ApoD plays a role in protecting cells from oxidative stress, neuroprotection, and modulation of inflammation. It has been linked to various physiological processes, including aging, neurodegenerative disorders, and cancer. In research, ApoD is studied to understand its functions in lipid homeostasis, and neuroprotection, and its potential implications in age-related diseases. Investigating ApoD's diverse roles contributes to our knowledge of lipid biology and its relevance to human health.

Target Background

Function

APOD occurs in the macromolecular complex with lecithin-transport and binding of bilin. Appears to be able to transport a variety of ligands in a number of different contexts.

Gene References into Functions

Study shows that in myelin maturation ApoD ultimately controls the removal of the sialic-rich hydrophilic glycocalyx, by maintaining functional integrity of lysosomes. A detailed analysis of the mechanism reveals that the proper localization of Neu1 and plasma membrane Neu3, as well as of the membrane-bound Fyn kinase, depend on ApoD. PMID: 29222871
apoD protein levels are variable across different brain regions. PMID: 26829325
It regulates amyloid plaque pathology in a mouse model of Alzheimer's disease PMID: 25784209
apoD may be part of an intrinsic cardioprotective system, possibly as a consequence of its antioxidation activity. PMID: 24082102
Changes in hypothalamus of ApoD(-/-) mice may indicate potential role of ApoD in regulation of endocrine functions of somatostatin in a receptor-dependent manner. PMID: 22581439
Abeta25-35 induces neuroprotective ApoD expression in hippocampal cells in response to stress-induced growth arrest. PMID: 22398376
The findings underscore the importance of ApoD in the regulation of plasma insulin levels and triglyceride metabolism, suggesting that ApoD plays an important role in the pathogenesis of dyslipidemia. PMID: 21632073
The data of this study supported that ApoD contributes to the endurance of astrocytes and decreases their reactivity level in vitro and in vivo PMID: 21688324
Scanning cytometry revealed PACAP/ApoD induced low density lipoprotein receptors (LDLR) and ApoE receptor 2 (apoER2) in NF200-positive cells. PMID: 20920539
mRNA and protein expression profiles reveal that ApoD is functionally connected in an age-dependent manner to specific molecular programs triggered by injury. PMID: 20607718
Apolipoprotein D plays a significant role in lipid metabolism. PMID: 20124557
This study concluded that glutamatergic pathways seem to be particularly affected in ApoD(-/-) mice. PMID: 19963028
Expression pattern of the lipocalin apolipoprotein D during mouse embryogenesis. PMID: 11744388
Apolipoprotein D-immunolabeled cells are observed in select grey matter nuclei, including the globus pallidus, thalamus, and substantia nigra, and in white matter tracts within the internal capsule and cerebellum of Neimann-Pick type C mouse brain. PMID: 12815234
apolipoprotein D and the lipogenic protein Spot 14 are LXR alpha and LXRB responsive genes both in vitro and in vivo PMID: 14703507
ApoD messenger RNA expression was localised to the spiral ligament and spiral limbus, particularly in the suprastrial and supralimbral regions. PMID: 15668042
These observations, together with its transcriptional up-regulation in the brain upon oxidative insult, identify ApoD as an acute response protein with a protective and therefore beneficial function mediated by the control of peroxidated lipids. PMID: 18419796
Taken together, our results describe receptor and region specific changes in SST and SSTR subtypes expression in ApoD(-/-) mice brain, which may be linked to specific neurological disorders. PMID: 19465111

Hide All

Subcellular Location

Secreted.

Protein Families

Calycin superfamily, Lipocalin family

Tissue Specificity

Highest levels of expression in brain, testis, virgin mammary gland and salivary gland. Moderate levels in skeletal muscle, lactating mammary gland and thymus. Low levels in lung and lymph node. No expression in kidney, pancreas, liver or spleen.

Database Links

KEGG: mmu:11815

STRING: 10090.ENSMUSP00000110885

UniGene: Mm.2082

Code	CSB-EP001935MO
Abbreviation	Recombinant Mouse Apod protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Apolipoprotein D (Apod)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage