Recombinant Mouse Asialoglycoprotein receptor 1 (Asgr1), partial

In Stock
Code CSB-EP002207MO
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Asgr1
Uniprot No.
Research Area
Others
Alternative Names
Asgr1; Asgr-1Asialoglycoprotein receptor 1; ASGP-R 1; ASGPR 1; Hepatic lectin 1; HL-1; mHL-1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
61-284aa
Target Protein Sequence
QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
52.8kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 61-284 constitute the expression domain of recombinant Mouse Asgr1. This Asgr1 protein is expected to have a theoretical molecular weight of 52.8 kDa. The Asgr1 protein was expressed in e.coli. The N-terminal GST tag was fused into the coding gene segment of Asgr1, making it easier to detect and purify the Asgr1 recombinant protein in the later stages of expression and purification.

The research on Asialoglycoprotein receptor 1 (Asgr1) spans liver physiology, plasma protein metabolism, and related disease mechanisms. Asgr1, located on the surface of liver cells, plays a crucial role in recognizing and binding glycoproteins lacking sugar residues in the bloodstream. Studies indicate that Asgr1 is pivotal in both the physiology and pathology of the liver. Its focus in current research lies in its ability to efficiently clear excess or aged glycoproteins from the bloodstream. As the body's largest metabolic organ, the liver utilizes Asgr1 to effectively eliminate outdated proteins, maintaining a healthy balance. In addition, Asgr1 is implicated in the study of certain diseases, particularly those related to the liver. For instance, some research suggests that Asgr1 may be associated with viral infections and the development of liver tumors, making it a potential target for the treatment and prevention of liver diseases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
Gene References into Functions
  1. the key roles of the ManR and ASGR in controlling circulating levels of numerous glycoproteins critical for regulating reproductive hormones and blood coagulation. PMID: 27405760
  2. Mice lacking the hepatocyte asialoglycoprotein receptor are more susceptible to the induction of T cell-mediated hepatitis suggesting a potentially significant role of the ASGPR in the homeostatic regulation of T cells in the liver. PMID: 23538026
  3. found that the asialoglycoprotein receptor (ASGPR) is involved in hepatocyte recognition of cells predestined for killing, including activated autologous T lymphocytes PMID: 21656538
  4. Asialoglycoprotein receptor 1 is a novel important factor that responds to endogenous lectins in the tumor microenvironment to promote metastasis by activating the epidermal growth factor receptor-extracellular signal-regulated kinase pathway. PMID: 21868757
  5. Asialoglycoprotein receptor functions to help regulate the concentration of glycoproteins bearing sialic acid alpha 2,6GalNAc in the blood. PMID: 16286643
  6. ERManI is required for trimming to Man(5-6)GlcNAc(2) and for endoplasmic reticulum associated degradation in cells in vivo. PMID: 18003979
  7. The Ashwell receptor is composed of type 2 transmembrane glycoproteins termed Asgr1 and Asgr2. Both are predominantly expressed in the liver. PMID: 18488037
  8. Proper ASGP receptor function protects against carbon tetrachloride-induced liver damage in a knockout mouse model lacking functional ASGP receptor. PMID: 19185565

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Tissue Specificity
Expressed exclusively in hepatic parenchymal cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*