Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Asgr1; Asgr-1Asialoglycoprotein receptor 1; ASGP-R 1; ASGPR 1; Hepatic lectin 1; HL-1; mHL-1
Species
Mus musculus (Mouse)
Expression Region
61-284aa
Target Protein Sequence
QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 61-284 constitute the expression domain of recombinant Mouse Asgr1. This Asgr1 protein is expected to have a theoretical molecular weight of 52.8 kDa. The Asgr1 protein was expressed in e.coli. The N-terminal GST tag was fused into the coding gene segment of Asgr1, making it easier to detect and purify the Asgr1 recombinant protein in the later stages of expression and purification.
The research on Asialoglycoprotein receptor 1 (Asgr1) spans liver physiology, plasma protein metabolism, and related disease mechanisms. Asgr1, located on the surface of liver cells, plays a crucial role in recognizing and binding glycoproteins lacking sugar residues in the bloodstream. Studies indicate that Asgr1 is pivotal in both the physiology and pathology of the liver. Its focus in current research lies in its ability to efficiently clear excess or aged glycoproteins from the bloodstream. As the body's largest metabolic organ, the liver utilizes Asgr1 to effectively eliminate outdated proteins, maintaining a healthy balance. In addition, Asgr1 is implicated in the study of certain diseases, particularly those related to the liver. For instance, some research suggests that Asgr1 may be associated with viral infections and the development of liver tumors, making it a potential target for the treatment and prevention of liver diseases.