Recombinant Mouse Asialoglycoprotein receptor 1(Asgr1),partial

Code CSB-YP002207MO
Product Type Recombinant Protein
Size US$2474
Uniprot No. P34927
Relevance Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been roved. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell mbrane surface.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Hepatic lectin 1 ;HL-1 ;mHL-1
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN
Research Area Others
Source Yeast
Gene Names Asgr1
Protein Names Hepatic lectin 1 ;HL-1 ;mHL-1
Expression Region 61-284aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 27.8 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.
Subcellular Location Membrane, Single-pass type II membrane protein
Tissue Specificity Expressed exclusively in hepatic parenchymal cells.
Database Links

KEGG: mmu:11889

STRING: 10090.ENSMUSP00000018699

UniGene: Mm.6559

Pathway Th17 cell differentiation
Thyroid hormone synthesis

Related Products

Asgr1 Antibodies

Asgr1 Antibodies for Mus musculus (Mouse)

Asgr1 Proteins

Asgr1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.