Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
Prss22; Bssp4; Prss26Brain-specific serine protease 4; BSSP-4; EC 3.4.21.-; Serine protease 22; Serine protease 26; Tryptase epsilon
Species
Mus musculus(Mouse)
Expression Region
33-306aa
Target Protein Sequence
ATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCADDRPGVYTSLLAHRSWVQRIVQGVQLRGYLADSGDTGSS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 33-306 constitute the expression domain of recombinant Mouse Prss22. The theoretical molecular weight of the Prss22 protein is 35.9 kDa. Expression of this Prss22 protein is conducted in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of Prss22, making it easier to detect and purify the Prss22 recombinant protein in the later stages of expression and purification.
The mouse brain-specific serine protease 4 (Bssp4), also known as Prss22, is an enzyme that belongs to the serine protease family and is primarily expressed in the brain. As a serine protease, Prss22 likely participates in the regulation of protein processing within neural tissues. Serine proteases, in general, are known for their involvement in various cellular functions, including synaptic plasticity, neuronal development, and modulation of signaling pathways.