Recombinant Mouse Brain-specific serine protease 4 (Prss22)

In Stock
Code CSB-EP880636MO
Abbreviation Recombinant Mouse Prss22 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Prss22
Uniprot No.
Research Area
Cell Biology
Alternative Names
Prss22; Bssp4; Prss26Brain-specific serine protease 4; BSSP-4; EC 3.4.21.-; Serine protease 22; Serine protease 26; Tryptase epsilon
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
33-306aa
Target Protein Sequence
ATIRVSPDCGKPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCADDRPGVYTSLLAHRSWVQRIVQGVQLRGYLADSGDTGSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 33-306 constitute the expression domain of recombinant Mouse Prss22. The theoretical molecular weight of the Prss22 protein is 35.9 kDa. Expression of this Prss22 protein is conducted in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of Prss22, making it easier to detect and purify the Prss22 recombinant protein in the later stages of expression and purification.

The mouse brain-specific serine protease 4 (Bssp4), also known as Prss22, is an enzyme that belongs to the serine protease family and is primarily expressed in the brain. As a serine protease, Prss22 likely participates in the regulation of protein processing within neural tissues. Serine proteases, in general, are known for their involvement in various cellular functions, including synaptic plasticity, neuronal development, and modulation of signaling pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*