Recombinant Mouse Cathepsin S (Ctss)

In Stock
Code CSB-EP006204MO
Abbreviation Recombinant Mouse ctss protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006204MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) ctss.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006204MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) ctss.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Ctss; CatsCathepsin S; EC 3.4.22.27
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
123-340aa
Target Protein Sequence
LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Intensify your research with our Recombinant Mouse ctss, also known as Cathepsin S. This protein, recombinantly produced in E.coli, serves as an essential tool in uncovering the intricate processes of cellular biochemistry. As a full-length mature protein (123-340aa), it provides a comprehensive understanding of the protein's function and structure.

Expressed with a N-terminal 6xHis-tag, our Cathepsin S ensures robust stability and efficient purification. With a purity greater than 90% as determined by SDS-PAGE, our Recombinant Mouse ctss stands up to the exacting standards of scientific research. Depending on your experimental needs, choose between a liquid form for immediate use, or a lyophilized powder for long-term storage and convenience.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules and MHC class II antigen presentation. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L.
Gene References into Functions
  1. The present data indicating that Cat-S activity increases with CKD progression suggest that Cat-S might be a therapeutic target to prevent cardiovascular complications in CKD. PMID: 28240259
  2. CatS(-/-) mice exhibited impaired social interaction and social novelty recognition in the three-chamber test. PMID: 28623134
  3. Cathepsin S activity controls injury-related vascular remodeling via TLR2/p38MAPK/PI3K/Akt/p-HDAC6 signaling pathway. PMID: 27365406
  4. Ctss induction during muscular dystrophy is a pathologic event that partially underlies disease pathogenesis, and its inhibition might serve as a new therapeutic strategy in Duchenne muscular dystrophy. PMID: 26966179
  5. Fluorogen substrate, Mca-GRWPPMGLPWE-Lys(Dnp)-DArg-NH2 can detect CTSS activities in mouse antigen presenting cells. PMID: 26899824
  6. Data show that cathepsins S (CatS) regulates CCL2 chemokine expression by modulation of CD74 antigen processing. PMID: 26358505
  7. Cathepsin S activates MrgprC11 and evokes receptor-dependent scratching in mice. PMID: 26216096
  8. cathepsin S deficiency alters the balance between adipocyte and osteoblast differentiation, increases bone turnover, and changes bone microarchitecture. Therefore, bone and fat metabolisms should be monitored when using cathepsin S inhibitors clinically PMID: 24780878
  9. results identify Cat-S as a biased agonist of PAR2 that causes PAR2- and TRPV4-dependent inflammation and pain. PMID: 25118282
  10. Cathepsin S contributes to macrophage migration via degradation of elastic fibre integrity to facilitate neointima formation of vein grafts PMID: 24319016
  11. CatS also reduced myocardial Smad2 and Smad3 activation and extra domain A fibronectin expression PMID: 23771947
  12. CatS is involved in the secondary injury after traumatic brain injury PMID: 24282339
  13. Disruption of CatS therefore induces hyperlocomotor activity due to failure to downscale the synaptic strength. PMID: 24067868
  14. These results show a peripheral pivotal role of CatS in the development of neuropathic pain through the antigen-specific activation of CD4(+) T-cells PMID: 24553941
  15. High cathepsin S promotes cancer growth and neovascularization. PMID: 23629809
  16. Provide direct evidence that Cat S plays an important role in abdominal aortic aneurysm formation in apoE-deficient mice. PMID: 22871592
  17. GILT expression decreased the proteolysis of a CatS selective substrate. PMID: 23012103
  18. Cathepsin S deficiency results in abnormal accumulation of autophagosomes in macrophages and enhances Ang II-induced cardiac inflammation. PMID: 22558139
  19. Overexpression of cathepsin S induces chronic atopic dermatitis in mice. PMID: 22170489
  20. Cat-S activates nociceptors to induce visceral pain via protease-activated receptor-2. PMID: 21802389
  21. only prophylactic Cat S inhibitor dosing blocked lung inflammation, consistent with our findings in Cat S knockout mice. PMID: 20855652
  22. Cathepsin S inhibition prevented the formation of lung granulomas in a mouse model of sarcoidosis. PMID: 21251246
  23. Cat S derived from macrophages is involved in the mechanisms of atherosclerotic plaque vulnerability in apoE-deficient mice PMID: 20079903
  24. For a subset of antigens, epitope generation is critically regulated by cathepsin S, which participates in antigen processing and generates qualitative and quantitative differences in the peptide repertoires displayed by MHC class II molecules. PMID: 11884425
  25. regulation of the phagosomal CatS, CatL, CatB and CatZ contents during dendritic cell activation PMID: 12186844
  26. cathepsin S contributes to angiogenesis by microvascular endothelial cells. PMID: 12600886
  27. In vivo, nonprofessional histocompatibility class (MHC) II-expressing antigen presenting cells of the intestinal epithelium use Cat S, but not Cat L, for MHC class II-mediated antigen presentation. PMID: 15661874
  28. First direct genetic evidence is reported for a key role of cathepsin S in autoimmune responses to acetylcholine receptor and in the pathogenesis of experimental autoimmune myasthenia gravis. PMID: 15661938
  29. Transgenic interferon-gamma induces alveolar epithelial cell DNA injury and apoptosis via a novel murine cathepsin S-dependent pathway, a critical event in the pathogenesis of alveolar remodeling, emphysema and inflammation. PMID: 15944319
  30. The increases in mRNA levels for CatS and GPX3 found in the aging C57BL/6 RPE/choroid appear to represent an increase in both the numbers of cells expressing these messages and an increase in the level of expression in individual cells. PMID: 15947738
  31. Cathepsin S has a unique role in determining the morphology of class II MHC-positive endosomal compartments PMID: 16094690
  32. interleukin-6-signal transducer and activator of transcription 3 -mediated increase of cathepsin S activity PMID: 16286017
  33. Data show that cathepsin S deficiency impairs angiogenesis and tumor cell proliferation, impairing angiogenic islet formation and the growth of solid tumors; while the absence of its endogenous inhibitor cystatin C resulted in opposite phenotypes. PMID: 16365041
  34. plays an important role in atherosclerotic plaque destabilization and rupture PMID: 16410454
  35. Plays role in migration and activation of microglia to protect facial motoneurons against axotomy-induced injury. PMID: 17539023
  36. These results indicate that seizures induced by kainate elicit neurodegeneration, astrogliosis, and microglial activation accompanied by the expression of cathepsin S while those induced by nicotine do not. PMID: 17997037
  37. Upregulation of elastase proteins results in aortic dilatation in mucopolysaccharidosis I mice. PMID: 18479957
  38. CAT S participates in inflammatory processes accompanying aging and pathologies of the central nervous system PMID: 18694734
  39. Leukocyte cathepsin S is a potent regulator of both cell and matrix turnover in advanced atherosclerosis. PMID: 19095996
  40. catS-induced elastolysis accelerates arterial and aortic valve calcification in chronic renal disease PMID: 19307473
  41. The active form of cathepsin S was identified as being significantly up-regulated in poorly differentiated TRAMP tumours. PMID: 19487544

Show More

Hide All

Subcellular Location
Lysosome. Secreted. Cytoplasmic vesicle, phagosome.
Protein Families
Peptidase C1 family
Tissue Specificity
Widely expressed with highest expression found in non-skeletal tissues. Relatively high levels found in skeletal tissues. Expressed in spleen, B cells, dendritic cells and macrophages.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*