Recombinant Mouse Collectrin (Cltrn),Partial

In Stock
Code CSB-EP861705MO
Abbreviation Recombinant Mouse Cltrn protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP861705MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tmem27.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP861705MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Tmem27.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Cltrn
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Cltrn; Nx17; Tmem27Collectrin; Transmembrane protein 27
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
15-141aa
Target Protein Sequence
ELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKVPNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNRINSAFFLDDHTLEFLKIPSTLAPPMEPSVP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.5kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Synthesizing the recombinant Mouse Cltrn protein generally involves integrating the DNA fragment that encodes the Mouse Cltrn protein (15-141aa) into a plasmid, introducing the recombinant plasmid into e.coli cells, followed by the selection and culturing of positive e.coli cells, induction of protein expression, and subsequent cell lysis. A N-terminal 10xHis-SUMO tag and C-terminal Myc tag is fused to the protein. The protein is purified through affinity purification, and SDS-PAGE analysis is conducted to confirm the presence of the protein and determine its purity. The protein's purity surpasses 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in amino acid transport by acting as binding partner of amino acid transporters SLC6A18 and SLC6A19, regulating their trafficking on the cell surface and their activity. May also play a role in trafficking of amino acid transporters SLC3A1 and SLC7A9 to the renal cortical cell membrane. Regulator of SNARE complex function. Stimulator of beta cell replication.
Gene References into Functions
  1. this study shows that Tmem27-mediated cross-presentation supports intrahepatic adaptive antiviral immune responses and may lead to insights into the nature of how the liver acts as a primary site of CD8+ T cell activation PMID: 28159899
  2. Collectrin is a consequential link between the transport of l-arginine and endothelial nitric oxide synthase uncoupling in hypertension. PMID: 24048198
  3. Collectrin and ACE2 in renal and intestinal amino acid transport. PMID: 21814048
  4. Tmem27 is a pancreatic beta cell transmembrane protein that regulates cell growth of pancreatic islets PMID: 16330324
  5. Our data suggest that collectrin is a novel mediator of renal amino acid transport and may provide further insight into the pathogenesis of a number of human disease correlates. PMID: 16985211
  6. data identify collectrin as a key regulator of renal amino acid uptake PMID: 17167413
  7. Collectrin has a role in amino acid transpor in the kidney [review] PMID: 17693757
  8. functional association of mutant B(0)AT1 transporters with ACE2 and collectrin in intestine and kidney, respectively, participates in the phenotypic heterogeneity of Hartnup disorder PMID: 19185582
  9. These data indicate the involvement of mitochondrial TCA cycle intermediates, distal to pyruvate, in the regulation of collectrin protein expression in beta-cells. PMID: 19715677

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
TMEM27 family
Tissue Specificity
Expressed on the apical surface of the proximal tubules in the renal cortex (at protein level). Kidney; collecting ducts and proximal tubule. Pancreas; beta cells of islets.
Database Links
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*