Recombinant Mouse Complement C1q subcomponent subunit A (C1qa)

Code CSB-BP003637MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP003637MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Research Area
Others
Alternative Names
C1qaComplement C1q subcomponent subunit A
Species
Mus musculus (Mouse)
Expression Region
23-245aa
Target Protein Sequence
EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
Mol. Weight
25.5kD
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet
Please contact us to get it.

Citations

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene References into Functions
  1. C1qa(-/-) mice did not show any differences in photoreceptor loss or inflammation at 7 days compared to wild-type PMID: 30126455
  2. The results presented here demonstrate that the C1q expression in aged females experience a distinct difference in brain aging when compared to age-matched males, suggesting females undergo a higher level of microglial activation with age. PMID: 28732515
  3. this study shows that regulatory dendritic cells can mediate a potent direct anti-inflammatory activity via the expression and/or secretion of molecules such as C1q, independently of their capacity to expand the pool of regulatory T cells PMID: 27731323
  4. Data preliminarily suggest that complement C1q activity may aid in the clearance of the Toxoplasma gondii parasite from the central nervous system and in so doing, have consequences for the connectivity of neighboring cells and synapses PMID: 27109609
  5. analysis of molecular signaling and inflammatory responses during ingestion of atherogenic lipoproteins modulated by complement protein C1q PMID: 27573737
  6. C1q-/- mice manifest increased frequency of fetal resorption, reduced fetal weight, and smaller litter size when compared to their wild-type counterparts PMID: 27687635
  7. This study demonstrated that microglia, but not neurons or peripheral sources, are the dominant source of C1q in the brain. PMID: 28264694
  8. findings show that C1q rather than FcgammaRs controls the Ab-mediated Ag uptake and its presentation by spleen APC subsets to T cells PMID: 28432146
  9. Demonstrate local synthesis of complement proteins by both PDGFRbeta-positive pericytes and CD45-positive cells in kidney fibrosis. PMID: 28052876
  10. Deleting C1qa gene significantly reduces synaptic pruning by Grn(-/-) microglia and mitigates neurodegeneration, behavioral phenotypes, and premature mortality in Grn(-/-) mice; results uncover a previously unrecognized role of progranulin in suppressing aberrant microglia activation during aging. PMID: 27114033
  11. C1q level may be a surrogate of prediction marker representing neurodegenerative disease progress before developing behavioral impairment. PMID: 26728245
  12. developmental mechanisms of C1qa may be re-engaged during injury response PMID: 27008854
  13. that inhibition of C1 is sufficient to preserve dendritic and synaptic architecture PMID: 27048300
  14. These findings support a role for locally synthesized C1q in promoting tumor growth. PMID: 26831747
  15. C1q is involved in the pristane-mediated enhanced inflammatory response to TLR7 stimulation. PMID: 26773156
  16. C1q has a role in pulmonary vascular homeostasis and preventing injury to lung endothelium PMID: 26487714
  17. Data (including data from studies in mutant mice) suggest exercise prevents age-related neurovascular decline, up-regulation of C1qa, and down-regulation of astrocytic Apoe; this preventive effect of exercise does not occur in Apoe-deficient mice. PMID: 26512759
  18. critical role in activation of beta-catenin signalling in hypertensive arterial remodelling PMID: 25716000
  19. G allele in rs172378 risk factor for lupus nephritis in a homozygous status PMID: 25326229
  20. Data (including data on knockout mice) suggest, in absence of Trem2 (triggering receptor expressed on myeloid cells 2), pulmonary macrophages selectively produce elevated levels of C1q resulting in enhanced phagocytosis during pneumococcal pneumonia. PMID: 24945405
  21. Complement protein C1q promotes macrophage anti-inflammatory M2-like polarization during the clearance of atherogenic lipoproteins PMID: 25091012
  22. C1q was significantly reduced in newly diagnosed schizophrenic patients or schizophrenic patients on medication compared with the controls. PMID: 23235303
  23. C1q induction and global complement pathway activation do not contribute to ALS toxicity in mutant SOD1 mice. PMID: 24170856
  24. The structural abnormalities, together with increased numbers of excitatory synapses, likely contribute to epileptogenesis in C1q KO mice. PMID: 23621154
  25. C1q-induced LRP1B and GPR6 proteins expressed early in Alzheimer disease mouse models, are essential for the C1q-mediated protection against amyloid-beta neurotoxicity PMID: 23150673
  26. These findings suggest that C1q recognizes an alternative binding partner expressed by stressed retinal ganglion cells. PMID: 22918632
  27. Findings suggest the unexpected role of complement C1q in Wnt signal transduction and modulation of mammalian aging. PMID: 22682250
  28. Our data indicate that C1q could have a role in regulating platelet activation and associated leukocyte recruitment during vessel wall injury. PMID: 22142906
  29. Levels of C1q rise substantially in retinal tissues over the course of degeneration. in the absence of C1q, cone photoreceptor function and viability are significantly compromised. PMID: 21863053
  30. analysis of the molecular mechanisms for synchronized transcription of three complement C1q subunit genes (A, B and C) in dendritic cells and macrophages PMID: 21862594
  31. Leukocyte recruitment and C1q-hemolytic activity was restored to wild type levels when CD93 was expressed on either hematopoietic cells or nonhematopoietic cells in bone marrow chimeric mice PMID: 21849679
  32. C1q, a marker of microglial activation, is upregulated in the nigrostriatal system following subchronic 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP); nigrostriatal dopaminergic injury is not affected by C1q in this model of Parkinson disease. PMID: 21640391
  33. Mice with a mutation in complement component 1a (C1qa) were protected from glaucoma. PMID: 21383504
  34. Complement 1q (C1q)-deficient mice lacking the classical complement pathway show significantly reduced survival and increased organ dysfunction, following cecal ligation and puncture when compared with control mice. PMID: 21263075
  35. C1q directly promotes neuronal survival, thereby demonstrating new interactions between immune proteins and neuronal cells that may facilitate neuroprotection. PMID: 21368058
  36. Ethanol activates the classical complement pathway via C1q binding to apoptotic cells in the liver and that C1q contributes to the pathogenesis of ethanol-induced liver injury. PMID: 20416309
  37. Complement protein C1q forms a complex with cytotoxic prion protein oligomers PMID: 20410306
  38. These results suggest that C1q and C3 facilitate the induction of intranasal tolerance. PMID: 20213737
  39. Bacterial titers of both Streptococcus pneumoniae serotype 6A and 14 in the middle ear lavage fluid samples from Bf/C2(-/)(-), Bf(-)(/)(-), and C1qa(-/)(-) mice were significantly higher than in samples from wild-type mice. PMID: 20065024
  40. C1q contributes to apoptotic cell clearance in vitro, but its genetic deletion has no effect on pulmonary apoptotic cell clearance in vivo. PMID: 12244199
  41. Elevated expression of splenic prion protein (PrP) may be dependent on C1q, since PrP up-regulation does not occur in spleens of C1q-deficient mice following treatment with preformed immune complexes or vesicular stomatitis virus. PMID: 12794132
  42. Evaluation using C1q-deficient mice shows that lung injury following gastrointestinal ischemia-reperfusion injury is independent of C1q and classical complement activation. PMID: 15879138
  43. alpha2beta1 integrin is a novel receptor for multiple collectins and the C1q complement protein PMID: 16166590
  44. The transmembrane lectin SIGN-R1 therefore contributes to innate resistance by an unusual C3 activation pathway. PMID: 16615889
  45. bacterial titers in the CNS were almost 12- and 20-fold higher in C1q- and C3-deficient-mice, respectively. Mean CSF leukocyte counts were reduced by 47 and 73% in C1q- and C3-deficient-mice, respectively PMID: 17237437
  46. The in vitro binding and activation of the human and mouse complement systems was analysed and the susceptibility to infection in complement-deficient mouse strains, was tested. PMID: 18501966
  47. C1q participates in scrapie prion protein PrP(Sc) uptake by conventional dendritic cells (cDCs), revealing a critical role for cDCs in initial prion capture, an event that takes place before the PrP(Sc) accumulation within the follicular DC network. PMID: 19155476
  48. IgM antibodies play a central role in protection against atherosclerosis; the mechanism appears to be at least partly independent of classical pathway complement activation by C1q PMID: 19620499
  49. ARRB2 acts to limit JNK/ERK activation and survival in macrophages. PMID: 19783052

Show More

Hide All

Subcellular Location
Secreted.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1