Recombinant Mouse Corticoliberin (Crh)

In Stock
Code CSB-EP811880MO
Abbreviation Recombinant Mouse Crh protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Crh
Uniprot No.
Research Area
Others
Alternative Names
(Corticotropin-releasing factor)(CRF)(Corticotropin-releasing hormone)
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
145-185aa
Target Protein Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-KSI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hormone regulating the release of corticotropin from pituitary gland. Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile.
Gene References into Functions
  1. Hypothalamic CRH-expressing neurons orchestrate complex behaviors after stress. PMID: 27306314
  2. Mice lacking corticotropin-releasing hormone, had an improved ability to escape away from potentially dangerous situations. PMID: 28786031
  3. our results suggest an inhibitory role of miR-212 on the HPA axis, which acts in a counter-regulatory manner. PMID: 28912247
  4. Study shows that prolactin was sufficient to suppress corticotrophin-releasing hormone (CRH) mRNA expression in the paraventricular nucleus, however it does not appear to be required for the ongoing regulation of the CRH neurones in lactation. PMID: 28744978
  5. Study blocked endogenous CRH using 2 chemically distinct antagonists of the principal hippocampal CRH receptor, CRHR1. The antagonists caused a modest reduction of spontaneous excitatory transmission onto CA3 pyramidal cells, mediated. This was accompanied by a decrease in incidence but not amplitude of sharp waves, indicating that CRH synaptic actions are sufficient to alter the output of a complex hippocampal network. PMID: 28460009
  6. Mice exposed to aggressive confrontations exhibited a similar pattern of species-typical aggressive and non-aggressive behaviors on the first and the last session. Repeated aggressive confrontations promoted an increase in plasma corticosterone. After 10 aggressive confrontation sessions, mice presented a non-significant trend toward reducing hippocampal levels of CRF, which inversely correlated with plasma corticosterone PMID: 28614436
  7. Data (including data from studies in transgenic mice) suggest that Crh alters Gnrh neuron activity and that estradiol is required for Crh to exert both stimulatory and inhibitory effects on Gnrh neurons. (Crh = corticotropin-releasing hormone; Gnrh = gonadotropin releasing hormone) PMID: 29069304
  8. The activation of parvalbumin(+) interneurons during morphine withdrawal was crucial for the induction of the negative emotion and the up-regulation of CRH mRNA levels in the central amygdala. PMID: 27385383
  9. Psychological stress-derived CRF can breach the established endotoxin tolerance in the intestinal mucosa. PMID: 23840363
  10. CRF plays a marked anxiogenic role at CRF1 receptors in the amygdala of mice exposed to the Elevated plus maze. PMID: 27060334
  11. GABAA receptor (GABAAR) and the Na(+)-K(+)-2Cl(-) cotransporter (NKCC1), but not the K(+)-Cl(-) cotransporter (KCC2), were expressed in the terminals of the CRH neurons at the median eminence (ME). In contrast, CRH neuronal somata were enriched with KCC2 but not with NKCC1. PMID: 27540587
  12. Excitability of genetically isolated CRF-receptive (CRFR1) neurons in the central nucleus of the amygdala (CeA) is potently enhanced by CRF and that CRFR1 signaling in the CeA is critical for discriminative fear PMID: 28017470
  13. activation of the Gq-membrane-associated estrogen receptors rapidly stimulates hypothalamic paraventricular nucleus CRH neurons by suppressing the M-current and potentiating glutamatergic neurotransmission PMID: 27387482
  14. Data describe a missing function of the stress hormone Crh in the regulation of autophagy activation and present evidence that this effect is linked to maintenance of gut homeostasis under basal conditions. PMID: 26987580
  15. Real-time PCR analyses revealed that social defeat significantly increased corticotropin-releasing hormone in the paraventricular nucleus. PMID: 25219790
  16. Data suggest a physiologically relevant role for local corticotropin-releasing hormone signaling towards shaping the neuronal circuitry within the mouse olfactory bulb. PMID: 25224546
  17. results suggest that long-term, post-natal CRF over-expression increases the rewarding effects of cocaine in individuals with high emotional response to stress. PMID: 25094033
  18. Knockdown of CRF synthesis in the ventral tegmental area prevented interpeduncular intermediate activation and anxiety during nicotine withdrawal. PMID: 25898242
  19. selective disruption of Grin1 within central amygdala CRF neurons strongly enhances fear memory PMID: 25340785
  20. it is shown that CRH and UCN upregulate galectin-1 expression in Ishikawa cell line and macrophages and this effect is mediated through CRHR1. PMID: 25473847
  21. CRF overexpression throughout the CNS increased startle magnitude and reduced ability to inhibit startle. CRF overexpression confined to inhibitory neurons decreased startle magnitude but had no effect on inhibitory measures. PMID: 25575243
  22. The stress response neuropeptide CRF increases amyloid-beta production by regulating gamma-secretase activity. PMID: 25964433
  23. These data suggest critical roles for CRF and CRFR1 in tau-P and aggregation and may have implications for the development of Alzheimer disease cognitive decline. PMID: 25125464
  24. Study of sex- and genotype-dependent effects of a short, acute predator odor exposure on CRF mRNA levels in stress-related brain regions and subsequently changes in spatial memory retrieval in male and female GAD67 mice and their wildtype littermates PMID: 24946072
  25. Chronic nicotine exposure upregulates corticotropin releasing factor mRNA in dopaminergic neurons of the posterior ventral tegmental area. PMID: 25402857
  26. Findings suggest that forebrain-specific overexpression of CRF (CRFOE) limited to development is sufficient to induce enduring alterations in startle plasticity and anxiety, while forebrain CRFOE during adulthood results in a different phenotype profile PMID: 24326400
  27. Data (including data from studies in knockout mice) suggest that Crh/Crhr1 signal transduction in noradrenergic neurons in cardiac ventricles during morphine withdrawal contributes to cardiovascular dysfunction, mimicking stress-induced dysfunction. PMID: 24490859
  28. Adiponectin regulates ACTH secretion and the hypothalamic-pituitary-adrenal axis in an AMPK-dependent manner in pituitary corticotroph cells. PMID: 24361598
  29. Impairment of CBP:CREB interaction reduces CRH expression in the hypothalamus on postnatal day nine, but does not disrupt steady-state CRH expression in adult mice PMID: 23768074
  30. These observations highlight basic cell-type characteristics of CRH neurons in a mutant mouse. PMID: 23724107
  31. corticotropin-releasing hormone knockouts are more susceptible to glucocorticoid receptor changes in early phases of stress. PMID: 23430272
  32. CRH was released during water avoidance stress (WAS) and inhibited NLRP6 expression. WAS induced alterations in the gut microbiota of mice; co-housed nonstressed mice developed enteritis associated with increased CRH and decreased levels of NLRP6. PMID: 23470617
  33. MicroRNA 375 mediates the signaling pathway of corticotropin-releasing factor (CRF) regulating pro-opiomelanocortin (POMC) expression by targeting mitogen-activated protein kinase 8. PMID: 23430746
  34. Corticotropin releasing factor expression was induced in the hippocampus of the mouse pilocarpine model of status epilepticus. PMID: 22326386
  35. Overexpression of CRF in Barrington's nucleus CRF in Barrington's nucleus inhibits bladder function and promotes active coping behavior. PMID: 22882375
  36. suggesting that perturbations of the CRF system are not the primary cause of decreased cognitive performance PMID: 22336193
  37. the NMDA receptor is positioned for the postsynaptic regulation of CRF expressing central nucleus of the amygdala neurons PMID: 23063907
  38. CRH and CRHR1 are dynamic modulators of a variety of signal transduction mechanisms and cellular processes. PMID: 22659651
  39. corticotropin-releasing factor (CRF), a neuropeptide released in response to acute stressors and other arousing environmental stimuli, acts in the nucleus accumbens of naive mice to increase dopamine release through coactivation of the receptors CRFR1 and CRFR2 PMID: 22992525
  40. Central CRH hyperdrive on its own or in combination with elevated glucocorticoids is responsible for the increase in anxiety-related behaviour. PMID: 22198557
  41. CRH plays an important role in stress induced hyperphosphorylation of tau protein. PMID: 22222439
  42. CRF suppressed GnRH protein levels, Ucn2 can modulate GnRH mRNA levels PMID: 22138165
  43. Ghrelin activates hypophysiotropic CRF neurons, albeit indirectly. PMID: 22363652
  44. Short-term central amygdala-corticotropin-releasing factor-overexpression enhanced the stress-induced anxiety-like behaviors in transgenic mice PMID: 21783178
  45. CRF(1) agonists, Ucn 1 and stressin(1) -A, reduced feeding and induced interoceptive stress, whereas Ucn 2 potently suppressed feeding via a CRF(2) -dependent mechanism without eliciting malaise [stressin 1-A] PMID: 21627635
  46. CRF signaling in the central nucleus of the amygdala is engaged during binge-like ethanol consumption by C57BL/6J mice. PMID: 22399763
  47. In mice with MECP2 duplication, reducing the levels of Crh or its receptor, Crhr1, suppressed anxiety-like behavior; in contrast, reducing Oprm1 expression improved abnormal social behavior. PMID: 22231481
  48. Leucine deprivation stimulates fat loss by increasing expression of corticotrophin-releasing hormone in the hypothalamus via activation of stimulatory G protein/cAMP/protein kinase A/cAMP response element-binding protein pathway. PMID: 21719534
  49. The immunomodulatory effects of CRH may include an important, albeit not explored yet, role in epidermal tissue remodeling and regeneration and maintenance of tissue homeostasis. PMID: 21765902
  50. These results show possible differential roles for CRF expressed by distinct loci of the extended amygdala, in mediating stress-induced emotional behaviors. PMID: 20548294

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Sauvagine/corticotropin-releasing factor/urotensin I family
Tissue Specificity
Expressed in parvocellular paraventricular nucleus of the hypothalamus and in medial accessory olivary nucleus.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*