Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Ctsc

Uniprot No.

P97821

Research Area

Others

Alternative Names

(Cathepsin C)(Cathepsin J)(Dipeptidyl peptidase I)(DPP-I)(DPPI)(Dipeptidyl transferase)(Dipeptidyl peptidase I exclusion domain chain)(Dipeptidyl peptidase I heavy chain)(Dipeptidyl peptidase I light chain)

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

25-134aa

Target Protein Sequence

DTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNW
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

20.1 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Thiol protease. Has dipeptidylpeptidase activity. Can act as both an exopeptidase and endopeptidase. Can degrade glucagon. Plays a role in the generation of cytotoxic lymphocyte effector function.

Gene References into Functions

Neutrophilic Cathepsin C Is Maturated by a Multistep Proteolytic Process and Secreted by Activated Cells during Inflammatory Lung Diseases. PMID: 26884336
A proteolytic cascade, involving cathepsins C and D, controls LLOMe-mediated necrosis. PMID: 25830414
CatC has a role in the selective tuning of innate and adaptive immune responses, relevant to a chronic immune disease, such as atherosclerosis. PMID: 25395616
Data indicate that all-trans retinoic acid (ATRA), which induces miR-23a expression, decreases cathepsin C (CTSC) expression and granzyme B activity leading to impaired NK cell cytotoxicity. PMID: 24440757
These results establish that DPPI is a major determinant of survival following Klebsiella pneumoniae lung infection and suggest that the survival disadvantage in DPPI(+/+) mice is in part due to processing of surfactant protein D by DPPI. PMID: 24955853
found no significant role for CtsC during mammary carcinogenesis but revealed squamous carcinogenesis to be functionally dependent on CtsC PMID: 24065739
Late stage cathepsin C, CXCL13 and Ki-67 overexpression correlate with regional neuropathology in a bovine spongiform encephalopathy transgenic murine model. PMID: 22789860
Proinflammatory cytokines induce expression and release of cathepsin C in microglial cells during neuroinflammatory progression. PMID: 22607609
The production of IL-1beta by macrophages, neutrophils, and mast cells in vitro is dependent on caspase-1 but not on cathepsin C. PMID: 22914048
NADPH oxidase in antimicrobial host defense against A. fumigatus and B. cepacia, whereas the proteases neutrophil elastase, cathepsin G, and lysosomal cysteine protease cathepsin C/ dipeptidyl peptidase I are dispensable PMID: 22163282
CatC is involved in limiting MCMV replication; however, this effect is independent of its role in promoting effector cytolytic activity. PMID: 20975734
Results indicate that mast cell dipeptidyl peptidase I (DPPI) harms the septic host and that DPPI is a novel potential therapeutic target for treatment of sepsis. PMID: 14966572
DPPI regulates a critical step in the development of collagen-induced arthritis that is independent of T cell and B cell functions. PMID: 16059912
Overall, our results indicate that although cathepsin C clearly generates the majority of granzyme B activity, some is still generated in its absence, pointing to alternative mechanisms for granzyme B processing and activation. PMID: 17283185
These findings suggest that DPPI and/or granule-associated serine proteases are necessary for neutrophil recruitment into the diseased aorta and that these proteases act to amplify vascular wall inflammation that leads to abdominal aortic aneurysms. PMID: 17301245
Role of DPPI and TIMP-3 in development of pulmonary fibrosis in early inflammation following bleomycin instillation. PMID: 17673693
DPPI is involved in recruitment of neutrophils following respiratory viral infection; absence of neutrophil-derived DPPI diminishes the acute inflammatory response and mucous cell metaplasia of the chronic asthma that follows Sendai virus infection. PMID: 18292580
Results indicate that DPPI cannot functionally compensate for the loss of TPPI. PMID: 18570628
Examination of mature enamel from DPPI null mice by FTIR showed no significant accumulation of protein; however, microhardness testing revealed that loss of DPPI expression significantly reduced enamel hardness. PMID: 19407151

Hide All

Subcellular Location

Lysosome.

Protein Families

Peptidase C1 family

Tissue Specificity

Broadly distributed, but higher levels found in lung, liver, kidney and spleen. Lower levels found in testis and brain.

Database Links

KEGG: mmu:13032

STRING: 10090.ENSMUSP00000032779

UniGene: Mm.322945

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP006186MO
MSDS	MSDS
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Dipeptidyl peptidase 1 (Ctsc), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage