Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Adam12

Uniprot No.

Q61824

Research Area

Signal Transduction

Alternative Names

Adam12; MltnaDisintegrin and metalloproteinase domain-containing protein 12; ADAM 12; EC 3.4.24.-; Meltrin-alpha

Species

Mus musculus(Mouse)

Source

Baculovirus

Expression Region

206-706aa

Target Protein Sequence

ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

58.4kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Mouse Adam12 was expressed with the amino acid range of 206-706. This Adam12 protein is expected to have a theoretical molecular weight of 58.4 kDa. This protein is generated in a baculovirus-based system. The N-terminal 10xHis tag and C-terminal Myc tag was fused into the coding gene segment of Adam12, making it easier to detect and purify the Adam12 recombinant protein in the later stages of expression and purification.

Adam12 (Disintegrin and metalloproteinase domain-containing protein 12) is a protein with protease activity, which is mainly involved in two research domains. Firstly, it plays a crucial role in extracellular matrix degradation, regulating protein degradation and remodeling in the extracellular matrix. This is vital for understanding tissue development, repair, and tumor invasion processes. Secondly, Adam12 is associated with the regulation of signaling pathways, particularly in cell proliferation, migration, and differentiation. This encompasses various physiological and pathological processes such as muscle development, tumor formation, and tissue repair.

Target Background

Function

Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors.

Gene References into Functions

In conclusion, MiR29a regulates endothelial cell ADAM12 upregulation in ischemia and this is impaired in hyperglycemia. PMID: 28637396
It was concluded that TNF-alpha-induced changes in extracellular matix components increased expression of ADAM12 among other changes that were temporally related with the onset of myocyte function. PMID: 27487498
ADAM12 and ADAM17 are essential molecules for the impairment of barrier function of retinal vasculature under hypoxia. PMID: 26242473
Augmentation of ADAM12 expression in vivo improved outcomes in Balb/c mice, whereas knockdown of ADAM12 made outcomes worse in C57Bl/6 mice. In vitro, ADAM12 expression modulates endothelial cell proliferation, survival, and angiogenesis. PMID: 26163448
The effect of insulin-like growth factor-I on ADAM12 expression during the course of myogenesis is reported. PMID: 26975138
Nitric oxide synthase deficiency has differential effects on ADAM12 expression in growing mouse brain. PMID: 25892053
Inhibition of Erbb2 suppressed the increase in metalloproteinase ADAM12 expression in skin tumors. PMID: 24798404
TGF-beta stimulation of renal cells results in a significant up-regulation of Adams 10, 17, 12, and 19 PMID: 24103556
ADAM12 enhanced ephrin-A1 cleavage in response to transforming growth factor-betra1 in primary tumors. PMID: 23686306
The endogenous SnoN plays a role in regulating ADAM12 expression in response to TGFbeta1. PMID: 20457602
Adam12 is spatiotemporally expressed in decidualizing stromal cells in intact pregnant females and in pseudopregnant mice undergoing artificially induced decidualization. PMID: 19841944
properly folded mouse ADAM12, after passing a rate-limiting step of exit from the ER, is processed in the secretory pathway and reaches the cell surface, where it can mediate adhesion-mediated signaling PMID: 12000744
These observations suggest Meltrin alpha may be involved in regulating adipogenesis and myogenesis through a linked developmental pathway.We also report here the chromosomal locations of Meltrin alpha in the mouse PMID: 12482960
Adam12 overexpression in skeletal muscle results in compenstaion for dystrophin- deficiency by increasing alpha7 integrin, utrophin and associated glycoproteins. PMID: 12915458
Role of metalloproteinase disintegrin ADAM12 in determination of quiescent reserve cells during myogenic differentiation in vitro was studied. PMID: 12972593
involvement of meltrin alpha in the development of obesity and in adipogenic cell proliferation. PMID: 15637293
novel protein-protein interaction reported here involving the extracellular domain of ADAM12 may have important biological consequences during myoblast differentiation PMID: 15849365
observations suggest that a disintegrin and metalloproteinase (ADAM)-8,-9,-10,-12,-15,and -17 play an important role in mouse uterine tissue remodelling during the oestrous cycle PMID: 15907280
ADAM12 is a potential target for design of drugs that prevent carcinoma growth and is essential for tumor development and progression in the W10 mouse model for prostate cancer. PMID: 16607276
endogenous ADAM9 and/or ADAM12 present in wild type mouse embryonic fibroblasts contribute to Dll1 processing PMID: 17107962
Adam12 contributes to Tgfb signaling through interaction with the type II receptor. PMID: 17620406
ADAM12 seemed to inhibit the satellite cell response and delay myoblast differentiation. PMID: 17982130
Breast cancer-associated mutations interfere with the intracellular trafficking of ADAM12 and result in loss of the functional ADAM12 at the cell surface. PMID: 18241035
Agonist signaling of both hypertension and hypertrophy depends on posttranscriptional and transcriptional mechanisms that involve MMP-7, which is transcriptionally connected with ADAM-12 PMID: 19398663
Findings provide the first in vivo evidence that agonist-induced cardiac hypertrophy and fibrosis processes are signaled through TACE, which acts through novel pathways involving transcriptional regulation of ADAM-12 and MMP-2. PMID: 19581512

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Tissue Specificity

Expressed during early developing mesenchymal cells that give rise to skeletal muscle, bones and visceral organs. Not expressed in adult normal muscle but expressed in regenerating muscle.

Database Links

KEGG: mmu:11489

STRING: 10090.ENSMUSP00000065213

UniGene: Mm.439714

Code	CSB-BP720263MO
Abbreviation	Recombinant Mouse Adam12 protein, partial
MSDS	MSDS Datasheet
Size	$472
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP720263MO could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12. Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP720263MO could indicate that this peptide derived from Baculovirus-expressed Mus musculus (Mouse) Adam12.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Disintegrin and metalloproteinase domain-containing protein 12 (Adam12), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage