Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1)

In Stock
Code CSB-BP804339MOb0
Abbreviation Recombinant Mouse Echs1 protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Echs1
Uniprot No.
Research Area
Cancer
Alternative Names
Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH)
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
28-290aa
Target Protein Sequence
ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) is produced using a baculovirus expression system and comes with an N-terminal 10xHis tag that makes purification and detection more straightforward. The protein covers the complete mature sequence from amino acids 28 to 290. Purity exceeds 85% based on SDS-PAGE analysis, which should provide dependable results for research work.

Enoyl-CoA hydratase, mitochondrial, appears to play a vital role in the beta-oxidation pathway during fatty acid metabolism. The enzyme catalyzes the hydration of enoyl-CoA to 3-hydroxyacyl-CoA—a step that seems essential for converting stored fats into energy the body can actually use. Understanding this enzyme may be key to grasping how metabolic processes and energy balance work, which is likely why it draws so much attention in metabolic research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Echs1 is a mitochondrial enoyl-CoA hydratase that requires precise folding, proper cofactor binding, and correct oligomerization for its functional activity in fatty acid β-oxidation. The baculovirus-insect cell expression system provides a eukaryotic environment that supports proper protein folding, post-translational modifications, and complex assembly, significantly increasing the probability of correct folding compared to bacterial systems. However, as a mitochondrial matrix protein, Echs1 may require mitochondrial-specific chaperones or processing for optimal activity. The N-terminal 10xHis tag is relatively small but may potentially interfere with the protein's mitochondrial targeting sequence or functional domains. While the baculovirus system offers favorable folding conditions, experimental validation remains essential to confirm functional hydratase activity.

1. Biochemical Characterization and Enzyme Kinetics Studies

This application's reliability depends on proper folding and functional validation. Enoyl-CoA hydratase activity requires precise tertiary structure and oligomerization. If correctly folded and active (verified), the protein is highly suitable for determining kinetic parameters and substrate specificity. If misfolded/inactive (unverified), enzymatic assays will yield negative or misleading results.

2. Antibody Development and Validation

Antibody development primarily relies on antigenic sequence recognition. If correctly folded (verified), the protein excels for generating conformation-sensitive antibodies. If misfolded/unverified, it remains highly suitable for producing antibodies against linear epitopes.

3. Protein-Protein Interaction Studies

This application requires proper folding validation. Mitochondrial fatty acid oxidation complex formation requires precise tertiary and quaternary structure. If correctly folded (verified), the protein is suitable for identifying physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding.

4. Comparative Species Analysis and Evolutionary Studies

Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and active (verified), the protein enables valid functional comparisons across species. If misfolded/inactive (unverified), comparative analyses would yield misleading evolutionary insights.

Final Recommendation & Action Plan

The baculovirus expression system provides favorable eukaryotic folding conditions for this mitochondrial enzyme, but experimental validation of structural integrity and enzymatic activity is essential before reliable use in functional studies. Begin with biochemical characterization to assess folding quality through size-exclusion chromatography (oligomerization state), circular dichroism spectroscopy, and validate hydratase activity using enoyl-CoA substrates. Once correct folding and functional activity are verified, proceed cautiously with Applications 1, 3, and 4 for kinetic studies, interaction mapping, and comparative analyses. Application 2 (antibody development) can proceed immediately regardless of folding status. If misfolding or lack of enzymatic activity is detected, limit applications to linear epitope antibody production and basic biophysical characterization, avoiding all functional studies. For reliable Echs1 research, always include appropriate activity controls using validated hydratase assays and consider the protein's mitochondrial context in experimental design.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate.
Gene References into Functions
  1. potential protein targets for the loss of PostC may include F(1)-ATPase gamma, Echs1 and Hsp20 that could regulate cellular ATP consumption/production and defense response to ischaemic stress PMID: 21722304
Subcellular Location
Mitochondrion matrix.
Protein Families
Enoyl-CoA hydratase/isomerase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*