Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1)

In Stock
Code CSB-BP804339MOb0
Abbreviation Recombinant Mouse Echs1 protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Echs1
Uniprot No.
Research Area
Cancer
Alternative Names
Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH)
Species
Mus musculus (Mouse)
Source
Baculovirus
Expression Region
28-290aa
Target Protein Sequence
ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) is produced using a baculovirus expression system and comes with an N-terminal 10xHis tag that makes purification and detection more straightforward. The protein covers the complete mature sequence from amino acids 28 to 290. Purity exceeds 85% based on SDS-PAGE analysis, which should provide dependable results for research work.

Enoyl-CoA hydratase, mitochondrial, appears to play a vital role in the beta-oxidation pathway during fatty acid metabolism. The enzyme catalyzes the hydration of enoyl-CoA to 3-hydroxyacyl-CoA—a step that seems essential for converting stored fats into energy the body can actually use. Understanding this enzyme may be key to grasping how metabolic processes and energy balance work, which is likely why it draws so much attention in metabolic research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Biochemical Characterization and Enzyme Kinetics Studies

Researchers can use this recombinant mouse Echs1 protein to explore the basic biochemical properties of enoyl-CoA hydratase in laboratory settings. Enzyme kinetics assays with different enoyl-CoA substrates may help determine important parameters like Km, Vmax, and catalytic efficiency. The relatively high purity (>85%) appears suitable for detailed mechanistic studies and analyzing substrate specificity. That N-terminal His-tag makes purification easier and allows for immobilization in continuous assay systems.

2. Antibody Development and Validation

This recombinant protein works well as an antigen for creating mouse Echs1-specific antibodies for research purposes. Since it includes the full-length mature protein (28-290aa), it likely provides broad epitope coverage for both monoclonal and polyclonal antibody production. The His-tag simplifies purification and quantification of the antigen, which should lead to more consistent immunization protocols. Researchers can then validate the resulting antibodies using this same recombinant protein in ELISA, Western blot, and immunoprecipitation assays.

3. Protein-Protein Interaction Studies

Scientists may find this recombinant Echs1 useful in pull-down assays when searching for potential binding partners in mitochondrial fatty acid oxidation pathways. The N-terminal His-tag works for immobilization on nickel-affinity matrices, making it possible to capture interacting proteins from mitochondrial lysates or purified protein libraries. Co-immunoprecipitation experiments could also help confirm specific protein interactions that initial screening approaches identify.

4. Comparative Species Analysis and Evolutionary Studies

This mouse recombinant protein can be studied alongside Echs1 orthologs from other species for comparative biochemical analysis. Such studies might reveal how catalytic mechanisms, substrate preferences, and structural stability have been conserved—or changed—across different mammalian species during evolution. Testing cross-reactivity with antibodies raised against this mouse protein may also shed light on epitope conservation and any species-specific differences in how Echs1 functions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate.
Gene References into Functions
  1. potential protein targets for the loss of PostC may include F(1)-ATPase gamma, Echs1 and Hsp20 that could regulate cellular ATP consumption/production and defense response to ischaemic stress PMID: 21722304
Subcellular Location
Mitochondrion matrix.
Protein Families
Enoyl-CoA hydratase/isomerase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*