Home
Protein
Recombinant Proteins
Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) (C225S)

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) (C225S)

^{In Stock}

Code	CSB-BP804339MO(M)
Abbreviation	Recombinant Mouse Echs1 protein (C225S)
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Echs1

Uniprot No.

Q8BH95

Research Area

Cancer

Alternative Names

Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH)

Species

Mus musculus (Mouse)

Source

Baculovirus

Expression Region

28-290aa(C225S)

Target Protein Sequence

ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQSAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal HA-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Elevate your cancer research with our Recombinant Mouse Echs1, also known as the Enoyl-CoA hydratase, or mECH. This mitochondrial protein, produced using baculovirus, is an essential tool for understanding the complex metabolic pathways involved in cancer progression.

Our Echs1 is a full-length mature protein (28-290aa, C225S mutation), offering a comprehensive view of its function and structure. The dual-tag system - N-terminal 10xHis-tag and C-terminal HA-tag, ensures its efficient purification and increased stability. With a purity greater than 85% as determined by SDS-PAGE, our Recombinant Mouse Echs1 meets the high standards required for precise scientific exploration. Choose between the immediate readiness of a liquid form or the longevity of a lyophilized powder to best fit your research workflow.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate.

Gene References into Functions

potential protein targets for the loss of PostC may include F(1)-ATPase gamma, Echs1 and Hsp20 that could regulate cellular ATP consumption/production and defense response to ischaemic stress PMID: 21722304

Subcellular Location

Mitochondrion matrix.

Protein Families

Enoyl-CoA hydratase/isomerase family

Database Links

KEGG: mmu:93747

STRING: 10090.ENSMUSP00000026538

UniGene: Mm.24452

Promotions