Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) (C225S)

In Stock
Code CSB-EP804339MO(M)
Abbreviation Recombinant Mouse Echs1 protein (C225S)
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Echs1
Uniprot No.
Research Area
metabolism
Alternative Names
Enoyl-CoA hydratase 1 Short-chain enoyl-CoA hydratase
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
28-290aa(C225S)
Target Protein Sequence
ASGANFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEQDPAVGAIVLTGGDKAFAAGADIKEMQNRTFQDCYSSKFLSHWDHITRVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVEKLVEEAIQSAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLFYSTFATDDRREGMTAFVEKRKANFKDH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal HA-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) is produced in E. coli and covers the full length of the mature protein from amino acids 28 to 290 with a C225S mutation. The protein features an N-terminal 10xHis tag and a C-terminal HA tag, which should make purification and detection more straightforward. SDS-PAGE analysis indicates it reaches a purity level greater than 85%, suggesting it's well-suited for various research applications.

Enoyl-CoA hydratase, mitochondrial (Echs1) appears to play a critical role in the fatty acid oxidation pathway. It catalyzes the hydration of enoyl-CoA to hydroxyacyl-CoA—a step that seems essential for breaking down fatty acids and extracting energy from them. This makes Echs1 particularly relevant for studies examining metabolic processes and energy homeostasis, potentially offering valuable insights into how cells manage their metabolism.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant mouse Echs1 (C225S) protein is unlikely to be correctly folded or fully bioactive without experimental validation. Echs1 is a mitochondrial enzyme involved in fatty acid β-oxidation, requiring precise folding for its enoyl-CoA hydratase activity. The E. coli expression system lacks the eukaryotic machinery for mitochondrial-specific folding, potentially leading to misfolding. The dual tags (N-terminal 10xHis and C-terminal HA) may sterically hinder proper folding, particularly as the C-terminal HA tag could disrupt the active site or oligomerization. The C225S mutation might affect structural stability or catalytic function, as cysteine residues can be involved in disulfide bonds or metal coordination. The purity >85% indicates impurities that could include misfolded species. Without validation (e.g., circular dichroism for secondary structure, enzyme activity assays), the protein's folding and bioactivity cannot be assured.

1. Biochemical Characterization of Mutant Enzyme Activity

This recombinant Echs1 (C225S) protein can be used for kinetic studies only if correct folding and enzymatic activity are experimentally verified. The dual tags may alter the active site conformation, leading to inaccurate Km or Vmax measurements. If misfolded, comparative studies with wild-type Echs1 may yield misleading results. It is recommended to first validate hydratase activity using substrates like crotonyl-CoA and remove tags if possible for reliable kinetics. The purity of>85% may require further purification for precise assays.

2. Protein-Protein Interaction Studies

The dual-tagged Echs1 mutant can be employed in pull-down assays, but interactions may be tag-mediated or non-specific if the protein is misfolded. The tags allow immobilization and detection, but biologically relevant binding partners in mitochondrial pathways may not be identified without native conformation. Validate folding using biophysical methods and include controls (e.g., tag-only proteins) to minimize artifacts. Results should be confirmed with full-length, tag-free Echs1.

3. Antibody Development and Validation

This recombinant protein can generate antibodies, but the dual tags may dominate the immune response, resulting in antibodies that primarily recognize tags rather than Echs1-specific epitopes. If misfolded, antibodies may not recognize native mitochondrial Echs1. For reliable outcomes, validate antibodies against tag-free Echs1 or endogenous protein from mouse tissues. The HA tag serves as a control but does not ensure specificity for the native enzyme.

4. Structural and Folding Studies

This protein is unsuitable for high-resolution structural studies (e.g., crystallography) without tag removal, as the tags introduce flexibility and heterogeneity. Biophysical techniques (e.g., circular dichroism) can assess general folding but may be confounded by tag contributions. The C225S mutation allows investigation of folding effects, but for meaningful insights, use tag-free protein and compare with wild-type. The purity of>85% is suboptimal for structural work.

5. In Vitro Metabolic Pathway Reconstitution

The recombinant Echs1 mutant can be incorporated into metabolic assays only if enzymatic activity is confirmed. Misfolding or tag interference may lead to inaccurate pathway efficiency measurements. Validate activity in a reconstituted system with other β-oxidation enzymes and use tag-free protein if possible. The tags aid monitoring but do not guarantee functional integrity.

Final Recommendation & Action Plan

To ensure reliable results, first validate the folding and bioactivity of the recombinant Echs1 (C225S) protein through techniques such as circular dichroism to confirm secondary structure, size-exclusion chromatography to assess oligomeric state, and enzyme activity assays using standard substrates like crotonyl-CoA. Given the potential interference from dual tags, remove them via proteolytic cleavage (if feasible) and re-purify the tag-free protein for functional studies. For applications like antibody development, use the current protein but thoroughly validate antibodies against native Echs1. In all cases, include appropriate controls, such as wild-type Echs1, tag-only proteins, and activity-negative mutants, to account for folding-related artifacts. Prioritize validation before quantitative biochemical or metabolic studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. Has high substrate specificity for crotonyl-CoA and moderate specificity for acryloyl-CoA, 3-methylcrotonyl-CoA and methacrylyl-CoA. It is noteworthy that binds tiglyl-CoA, but hydrates only a small amount of this substrate.
Gene References into Functions
  1. potential protein targets for the loss of PostC may include F(1)-ATPase gamma, Echs1 and Hsp20 that could regulate cellular ATP consumption/production and defense response to ischaemic stress PMID: 21722304
Subcellular Location
Mitochondrion matrix.
Protein Families
Enoyl-CoA hydratase/isomerase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*