Recombinant Mouse Fas apoptotic inhibitory molecule 3 (Fcmr), partial

In Stock
Code CSB-EP007972MO
Abbreviation Recombinant Mouse Faim3 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Fcmr
Uniprot No.
Research Area
Others
Alternative Names
Fcmr; Faim3; TosoFas apoptotic inhibitory molecule 3; IgM Fc fragment receptor; Regulator of Fas-induced apoptosis Toso
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
18-262
Target Protein Sequence
RVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.9kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 18-262 constitute the expression domain of recombinant Mouse Faim3. The theoretical molecular weight of the Faim3 protein is 43.9 kDa. Expression of this Faim3 protein is conducted in e.coli. The Faim3 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant Faim3 protein during the following stages.

Mouse Fas apoptotic inhibitory molecule 3 (Faim3), also known as Fcmr, plays a crucial role in regulating apoptosis, particularly in immune cells. Fcmr functions as a cell surface receptor that modulates Fas-mediated apoptosis, impacting immune responses. Fcmr is implicated in both promoting and inhibiting apoptosis in lymphocytes, depending on the cellular context. Beyond apoptosis regulation, Fcmr is involved in modulating B cell activation and tolerance. Research on Fcmr spans various areas, including immune system regulation, autoimmune diseases, and cancer. Understanding its function provides insights into potential therapeutic strategies for immune-related disorders and cancer treatments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation.
Gene References into Functions
  1. Toso has an essential role in the differentiation and maturation of iDCs, a process that is required for the control of persistence-prone virus infection. PMID: 25257173
  2. these findings suggest that FcmuR plays important roles in the regulation of auto-antibody production, Mott cell formation and the differentiation of MZ B cells into plasma cells in B6.MRL Fas (lpr/lpr) mice. PMID: 24994818
  3. FCMR is required for B cell differentiation and homeostasis, the prevention of autoreactive B cells, and responsiveness to antigenic challenge. PMID: 23267023
  4. Toso is a unique regulator of inflammatory autoimmune responses with a protective role against experimental autoimmune encephalomyelitis PMID: 24398517
  5. Toso is a unique regulator of innate immune responses during bacterial infection and septic shock. PMID: 23359703
  6. These results identify TOSO/FAIM3 as a receptor for IgM PMID: 20042454
  7. mTOSO overexpressing primary T lymphocytes are resistant to Fas/Fas ligand-induced apoptosis. PMID: 15632112

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*