Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Fcmr; Faim3; TosoFas apoptotic inhibitory molecule 3; IgM Fc fragment receptor; Regulator of Fas-induced apoptosis Toso
Species
Mus musculus (Mouse)
Target Protein Sequence
RVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 18-262 constitute the expression domain of recombinant Mouse Faim3. The theoretical molecular weight of the Faim3 protein is 43.9 kDa. Expression of this Faim3 protein is conducted in e.coli. The Faim3 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant Faim3 protein during the following stages.
Mouse Fas apoptotic inhibitory molecule 3 (Faim3), also known as Fcmr, plays a crucial role in regulating apoptosis, particularly in immune cells. Fcmr functions as a cell surface receptor that modulates Fas-mediated apoptosis, impacting immune responses. Fcmr is implicated in both promoting and inhibiting apoptosis in lymphocytes, depending on the cellular context. Beyond apoptosis regulation, Fcmr is involved in modulating B cell activation and tolerance. Research on Fcmr spans various areas, including immune system regulation, autoimmune diseases, and cancer. Understanding its function provides insights into potential therapeutic strategies for immune-related disorders and cancer treatments.