Recombinant Mouse Filamin-A (Flna), partial

Code CSB-MP804854MO1
Abbreviation Recombinant Mouse Flna protein, partial
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Actin-binding protein 280;Alpha-filamin;Endothelial actin-binding protein;Filamin-1;Non-muscle filamin
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
500-750aa
Target Protein Sequence
TADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.1 kDa
Protein Length
Partial
Tag Info
C-terminal G4S-10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Actin binding protein that promotes orthogonal branching of actin filaments and links actin filaments to membrane glycoproteins. Anchors various transmembrane proteins to the actin cytoskeleton and serves as a scaffold for a wide range of cytoplasmic signaling proteins. Interaction with FLNB may allow neuroblast migration from the ventricular zone into the cortical plate. Tethers cell surface-localized furin, modulates its rate of internalization and directs its intracellular trafficking. Involved in ciliogenesis. Plays a role in cell-cell contacts and adherens junctions during the development of blood vessels, heart and brain organs. Plays a role in platelets morphology through interaction with SYK that regulates ITAM- and ITAM-like-containing receptor signaling, resulting in by platelet cytoskeleton organization maintenance. During the axon guidance process, required for growth cone collapse induced by SEMA3A-mediated stimulation of neurons.
Gene References into Functions
  1. FlnA and Fmn2 are likely essential to cell proliferation, differentiation and cell death in a variety of tissues and organs, further reiterating the importance of vesicle trafficking in regulation of development PMID: 29240780
  2. both LRP1 and LDLR expression and agLDL uptake are regulated by P2Y2R in vascular smooth muscle cells, and agLDL uptake due to P2Y2R activation is dependent upon cytoskeletal reorganization mediated by P2Y2R binding to FLN-A PMID: 27522265
  3. FlnA is a negative regulator of beta2 integrin-dependent cell adhesion and reactive oxygen species production but is required for neutrophil extracellular traps production in primary murine neutrophils PMID: 28986439
  4. Here the authors report that intermediate progenitor's neuron production is enhanced by abrogating filamin function, leading to the generation of periventricular neurons independent of normal neocortical neurogenesis and neuronal migration. PMID: 27664421
  5. These results show that FLNA plays crucial roles in asymmetric division during meiotic maturation by regulating ROCK-cofilin-mediated actin reorganization. PMID: 28487281
  6. FlnA binding to PACSIN2 F-BAR domain regulates membrane tubulation in megakaryocytes and platelets. PMID: 25838348
  7. FlnA is a critical upstream element of the signaling cascade underlying the myogenic tone. PMID: 26923587
  8. Bones lacking filamin A are protected from estrogen-mediated post-menopausal osteoporosis PMID: 25894069
  9. findings suggest a model in which filamin A local translation following axon injury controls localized HDAC5 activity to promote axon regeneration. PMID: 26157139
  10. Deletion of filamin A in endothelial cells aggravated myocardial infarction-induced left ventricle dysfunction and cardiac failure as a result of defective endothelial response PMID: 25344364
  11. A new signaling set, phosphatidic acid-S6K1-FLNA-actin, sheds light into the morphogenic pathway of cytoskeletal structures that are crucial for adhesion and cell locomotion during inflammation and metastasis. PMID: 25512366
  12. Filamin-A is associated with neutrophil uropod retraction. PMID: 24205360
  13. a major function of FLNa in modulating ion channel abundance and membrane trafficking in neurons, thereby shaping their biophysical properties and function. PMID: 24403084
  14. FLNA, a large cytoskeletal actin-binding protein, physically interacts with HIF-1alpha and promotes tumor growth and angiogenesis. PMID: 24550283
  15. filamin reduces ENaC channel function through direct interaction on the cell surface PMID: 23161538
  16. Heart valve interstitial cells, through a serotonin, transglutaminase, and filamin-A pathway, regulate matrix organization during fetal valve development. PMID: 22843703
  17. FLNA is important for lung tumor growth and that endothelial Flna impacts local tumor growth. PMID: 22857000
  18. Filamin A interacts with Big2 and overexpression of Filamin A interfers with neuronal migration. PMID: 22956851
  19. Loss of filamin A expression is associated with increases in the frequency of dysmorphology and severity of ciliopathy developmental defects caused by mks3 knockdown PMID: 22121117
  20. FLNa is involved in podosome stability and their organization as rosettes and three-dimensional podosomes in macrophages. PMID: 22334688
  21. these data demonstrate that coordinated expression of GPIbalpha and filamin is required for efficient trafficking of either protein to the cell surface, and for production of normal-sized platelets. PMID: 22174152
  22. FlnA stabilizes the platelet von Willebrand factor receptor, as surface expression of von Willebrand factor receptor components is normal on FlnA-null MKs but decreased on FlnA-null platelets. PMID: 21652675
  23. Filamins A and B have a major role in the maintenance of actin-based mechanical linkages that enable endoplasmic spreading and microtubule extension as well as sustained traction forces and mature focal adhesions. PMID: 21325628
  24. In mice, complete loss of Filamin A expression causes embryonic lethality with severe defects in cardiovascular formation and bone development. (Review) PMID: 21169733
  25. Data show that filamin-A is robustly expressed in non-myocyte cells throughout cardiac morphogenesis including epicardial and endocardial cells, and mesenchymal cells derived by EMT from these two epithelia, as well as mesenchyme of neural crest origin. PMID: 20549728
  26. findings reveal that the interaction between FlnA and Syk regulates ITAM- and ITAM-like-containing receptor signaling and platelet function PMID: 20713593
  27. filamin A is required for osteoclastogenesis by regulating actin dynamics via Rho GTPases that control monocyte migration. PMID: 19929439
  28. Data suggest that filamin A association with caveolin-1 promotes caveolae-mediated transport by regulating vesicle internalization, clustering, and trafficking. PMID: 19759182
  29. In filamin- cells the gating kinetics of HCN1 were strongly accelerated relative to filamin+ cells. PMID: 15292205
  30. T-to-A transversion that converts a tyrosine codon to a stop codon in the Flna gene (Y2388X), leading to absence of the Flna protein, male lethality, cardiac malformations and skeletal defects in female. PMID: 16825286
  31. Flna-null embryos display abnormal epithelial and endothelial organization and aberrant adherens junctions in developing blood vessels, heart, brain, and other tissues PMID: 17172441
  32. Review explores the pathogenesis of persistent periventricular nodular heterotopia with respect to filamin-A (FLNa) mutations with mouse models. [review] PMID: 18201775
  33. This study demonstrates that P2Y(2)R/FLNa interaction selectively regulates spreading and migration of vascular SMCs. PMID: 18202316
  34. Wnt5a/Ror2 activates JNK, through a process involving filamin A and PKCzeta, to regulate polarized cell migration. PMID: 18667433
  35. These findings support a role for FLNa-beta1 integrin as a mechanosensitive complex that bidirectionally senses the tension of the matrix and, in turn, regulates cellular contractility and response to this matrix tension. PMID: 19458194

Show More

Hide All

Subcellular Location
Cytoplasm, cell cortex. Cytoplasm, cytoskeleton. Perikaryon. Cell projection, growth cone.
Protein Families
Filamin family
Tissue Specificity
Widely expressed. Highly expressed in Purkinje cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*