Recombinant Mouse Gamma-interferon-inducible lysosomal thiol reductase (Ifi30)

In Stock
Code CSB-YP872152MO
Abbreviation Recombinant Mouse Ifi30 protein
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
55-230aa
Target Protein Sequence
PSPPVRVSLYYESLCGACRYFLVRDLFPTWLMVMEIMNITLVPYGNAQERNVSGTWEFTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQVYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELLSIVCQLYQGTE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lysosomal thiol reductase that can reduce protein disulfide bonds. May facilitate the complete unfolding of proteins destined for lysosomal degradation. Plays an important role in antigen processing. Facilitates the generation of MHC class II-restricted epitodes from disulfide bond-containing antigen by the endocytic reduction of disulfide bonds. Facilitates also MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T-cells or crosspresentation.
Gene References into Functions
  1. GILT has a role in maintaining cysteine cathepsin proteolytic efficiency in phagosomes PMID: 25253686
  2. These results show that wild-type mouse fibroblasts are relatively resistant and GILT(-/-)mouse fibroblasts are susceptible to Dengue virus 2 entry and replication. PMID: 23642353
  3. Data indicate that in the absence of Gamma-interferon-inducible lysosomal thiol reductase (GIL, CD4-positive T cell responses to major house dust mite allergen Der p 1 are significantly reduced. PMID: 23326313
  4. GILT has a critical role in regulating CD4(+) T-cell tolerance to an endogenous skin-restricted antigen relevant to controlling autoimmunity and generating effective immunotherapy for melanoma. PMID: 21833020
  5. gene knock-outs increase oxidative stress and autophagy, which is regulated by altering glutathione synthesis and oxidation PMID: 21640818
  6. GILT has limited yet unexpected effect on self-peptide species presented by major histocompatibility complex class II antigens. PMID: 20485683
  7. study shows GILT facilitates MHC class I-restricted recognition of exogenous antigens containing disulfide bonds by CD8+ T cells or cross-presentation;initiation of gB-specific CD8+ T cell response during HSV-1 infection or cross-priming is GILT-dependent PMID: 20538950
  8. the thiol reductase activity of GILT is its essential function in MHC class II-restricted Ag processing PMID: 17142755
  9. findings show that endogenously produced peptide-IgG is processed by transduced splenic B cells in the lysosomes/endosomes in a GILT-dependent manner, and this endocytic processing pathway is essential for generating tolerogenic B cells PMID: 18606668
  10. Replication of Listeria monocytogenes in GILT-negative macrophages, or macrophages expressing an enzymatically inactive GILT mutant, is impaired because of delayed escape from the phagosome PMID: 18815593
  11. Expression of GILT in T-lymphocytes increases as a function of maturity, thereby reducing sensitivity of T-cells and consequences of autoimmune responses; a role of GILT in the immune system may be in reducing the impact of T-cell autoreactivity. PMID: 19124716
  12. GILT facilitated the processing and presentation to antigen-specific T cells of protein antigens containing disulfide bonds. PMID: 11701933

Show More

Hide All

Subcellular Location
Secreted. Lysosome.
Protein Families
GILT family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*