Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct)

In Stock
Code CSB-YP019135MO
Abbreviation Recombinant Mouse Qpct protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Qpct
Uniprot No.
Research Area
Neuroscience
Alternative Names
Qpct; Glutaminyl-peptide cyclotransferase; EC 2.3.2.5; Glutaminyl cyclase; QC; Glutaminyl-tRNA cyclotransferase
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
36-362aa
Target Protein Sequence
AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant mouse Glutaminyl-peptide cyclotransferase (Qpct) is expressed in a yeast system, which appears to offer a reliable and efficient production method. The protein carries an N-terminal 6xHis-tag that helps with purification and detection. It includes the full length of the mature protein, spanning amino acids 36 to 362. The product shows purity levels exceeding 90%, as confirmed by SDS-PAGE analysis, which likely ensures high-quality results for research applications.

Glutaminyl-peptide cyclotransferase (Qpct) is an enzyme that participates in the post-translational modification of proteins. It plays what appears to be a critical role in converting glutaminyl residues into pyroglutamyl residues—a modification that seems important for protein stability and function. This enzyme may be relevant in various physiological pathways and has become a subject of interest for researchers studying protein processing and regulation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant mouse Qpct is produced in a yeast expression system as the full-length mature protein (36-362aa) with an N-terminal 6xHis-Flag tag. Yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation and some post-translational modifications, which are important for Qpct's enzymatic activity in catalyzing N-terminal glutaminyl cyclization. As a full-length protein expressed in a eukaryotic system, it has a high probability of correct folding. However, Qpct requires precise active site formation and may need proper metal cofactor incorporation for activity. The dual His-Flag tag at the N-terminus is relatively large and may potentially interfere with protein folding or function. No validation data (e.g., enzymatic activity assays, circular dichroism) are provided. Therefore, while yeast expression increases the probability of correct folding, the protein's enzymatic activity cannot be confirmed without experimental validation.

1. Biochemical Characterization and Enzyme Kinetics Studies

If the recombinant Qpct is correctly folded and functional, it can be used for enzyme kinetics studies to characterize substrate specificity and kinetic parameters. However, if inactive (due to improper folding, lack of cofactors, or tag interference), activity assays would yield invalid results. The His-Flag tag may sterically hinder the active site or substrate access even with correct folding.

2. Antibody Development and Validation

This application is suitable, as antibody generation primarily relies on linear epitope recognition. The full-length protein provides comprehensive epitope coverage. However, if misfolded, antibodies may not optimally recognize conformational epitopes of native Qpct in biological contexts.

3. Protein-Protein Interaction Studies

If properly folded, the His-tagged Qpct could be used in pull-down assays to identify interaction partners. However, if misfolded, interaction domains may be altered, leading to non-specific binding. The large dual tag may also cause steric hindrance in some interactions.

4. Structural and Biophysical Analysis

If correctly folded, the protein is suitable for structural studies, but the His-Flag tag should be removed for high-resolution structural determination (X-ray crystallography, NMR) as it may interfere with crystallization or analysis. For biophysical characterization, the tag may slightly alter hydrodynamic properties.

5. Comparative Species Studies and Evolutionary Analysis

If functionally active, the recombinant Qpct enables valid comparative studies with orthologs from other species. However, activity validation is essential first, as improper folding would make cross-species comparisons biologically meaningless.

Final Recommendation & Action Plan

This yeast-expressed full-length Qpct has a high probability of proper folding due to the eukaryotic expression system, but requires validation before functional applications. The recommended action plan includes: (1) Validate enzymatic activity using specific glutaminyl peptide substrates with appropriate controls; (2) Confirm proper folding through biophysical methods (circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state); (3) For structural studies, consider removing the dual tag proteolytically for highest resolution analysis; (4) Antibody development can proceed immediately, but validate antibodies against native Qpct; (5) For comparative studies, ensure all compared proteins are similarly validated for activity. Always include positive controls (known active Qpct) in functional experiments. If validation confirms activity, proceed with applications while noting potential tag interference; if inactive, consider using tag-free protein or alternative expression systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue.
Gene References into Functions
  1. Authors identified a placenta-specific imprinted gene Qpct. Results show that Qpct is widely expressed during early embryonic development and can be detected in the telencephalon, midbrain, and rhombencephalon at E9.5-E11.5. PMID: 26447138
  2. co-regulation of the enzyme glutaminyl cyclase and its substrate TRH was reflected by a co-induction of both proteins in reactive astrocytes in proximity of Abeta deposits PMID: 25446989
  3. This study provide a thorough comparative characterization of the glutaminyl cyclases QC and isoQC in defined brain regions of different inbred and outbred mouse strains PMID: 24886834
  4. This study presents a first comparison of two mammalian QCs (mouse and human)containing typical, conserved post-translational modifications. PMID: 21671571
  5. Glutaminyl cyclase in a mouse knockout model has a role in hypothyroidism but not hypogonadism PMID: 21330373
  6. QC is crucial for modulating AbetapE3-42 levels in vivo and prove on a genetic base the concept that reduction of QC activity is a promising new therapeutic approach for AD. PMID: 21148560
  7. Murine isoQC proteins displayed a broad substrate specificity and preference for hydrophobic substrates, similar to the related QC. PMID: 19804409
  8. Results describe the expression of glutaminyl cyclase throughout the mouse brain during early postnatal development. PMID: 19699792
  9. The observations of this study indicated that brain ischemia might be a pathogenic factor of alzheimer disease through increasing BACE1, cathepsin B, and glutaminyl cyclase. PMID: 19809370
  10. QC is a zinc-dependent catalyst PMID: 16201766

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glutaminyl-peptide cyclotransferase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*