Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct)

In Stock
Code CSB-YP019135MO
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Qpct
Uniprot No.
Research Area
Neuroscience
Alternative Names
Qpct; Glutaminyl-peptide cyclotransferase; EC 2.3.2.5; Glutaminyl cyclase; QC; Glutaminyl-tRNA cyclotransferase
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
36-362aa
Target Protein Sequence
AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
39.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue.
Gene References into Functions
  1. Authors identified a placenta-specific imprinted gene Qpct. Results show that Qpct is widely expressed during early embryonic development and can be detected in the telencephalon, midbrain, and rhombencephalon at E9.5-E11.5. PMID: 26447138
  2. co-regulation of the enzyme glutaminyl cyclase and its substrate TRH was reflected by a co-induction of both proteins in reactive astrocytes in proximity of Abeta deposits PMID: 25446989
  3. This study provide a thorough comparative characterization of the glutaminyl cyclases QC and isoQC in defined brain regions of different inbred and outbred mouse strains PMID: 24886834
  4. This study presents a first comparison of two mammalian QCs (mouse and human)containing typical, conserved post-translational modifications. PMID: 21671571
  5. Glutaminyl cyclase in a mouse knockout model has a role in hypothyroidism but not hypogonadism PMID: 21330373
  6. QC is crucial for modulating AbetapE3-42 levels in vivo and prove on a genetic base the concept that reduction of QC activity is a promising new therapeutic approach for AD. PMID: 21148560
  7. Murine isoQC proteins displayed a broad substrate specificity and preference for hydrophobic substrates, similar to the related QC. PMID: 19804409
  8. Results describe the expression of glutaminyl cyclase throughout the mouse brain during early postnatal development. PMID: 19699792
  9. The observations of this study indicated that brain ischemia might be a pathogenic factor of alzheimer disease through increasing BACE1, cathepsin B, and glutaminyl cyclase. PMID: 19809370
  10. QC is a zinc-dependent catalyst PMID: 16201766

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glutaminyl-peptide cyclotransferase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*