Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct)

In Stock
Code CSB-YP019135MO
Abbreviation Recombinant Mouse Qpct protein
MSDS
Size $368
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Qpct
Uniprot No.
Research Area
Neuroscience
Alternative Names
Qpct; Glutaminyl-peptide cyclotransferase; EC 2.3.2.5; Glutaminyl cyclase; QC; Glutaminyl-tRNA cyclotransferase
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
36-362aa
Target Protein Sequence
AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant mouse Glutaminyl-peptide cyclotransferase (Qpct) is expressed in a yeast system, which appears to offer a reliable and efficient production method. The protein carries an N-terminal 6xHis-tag that helps with purification and detection. It includes the full length of the mature protein, spanning amino acids 36 to 362. The product shows purity levels exceeding 90%, as confirmed by SDS-PAGE analysis, which likely ensures high-quality results for research applications.

Glutaminyl-peptide cyclotransferase (Qpct) is an enzyme that participates in the post-translational modification of proteins. It plays what appears to be a critical role in converting glutaminyl residues into pyroglutamyl residues—a modification that seems important for protein stability and function. This enzyme may be relevant in various physiological pathways and has become a subject of interest for researchers studying protein processing and regulation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Biochemical Characterization and Enzyme Kinetics Studies

This recombinant mouse Qpct protein can be used to investigate the fundamental biochemical properties of glutaminyl-peptide cyclotransferase. Researchers might examine substrate specificity, optimal reaction conditions, and kinetic parameters. The high purity (>90%) and N-terminal His-tag make purification and handling more straightforward for detailed enzymatic assays. Scientists can study the enzyme's ability to catalyze the cyclization of N-terminal glutaminyl residues in various peptide substrates. Such studies would likely contribute to understanding the molecular mechanisms underlying this post-translational modification process in mouse systems.

2. Antibody Development and Validation

The purified recombinant protein serves as an excellent antigen for generating specific antibodies against mouse Qpct. The His-tag allows for easy immobilization on metal-affinity surfaces during immunization protocols or screening assays. Generated antibodies can be validated using this recombinant protein in techniques such as ELISA, Western blotting, and immunoprecipitation experiments. This application appears particularly valuable for researchers developing tools to study Qpct expression and localization in mouse tissues and cell lines.

3. Protein-Protein Interaction Studies

The His-tagged recombinant Qpct can be used in pull-down assays to identify potential binding partners or regulatory proteins that interact with glutaminyl-peptide cyclotransferase. The tag makes immobilization on nickel-based affinity matrices more straightforward, allowing researchers to capture interacting proteins from mouse cell lysates or tissue extracts. These interaction studies might reveal novel regulatory mechanisms or functional complexes involving Qpct in cellular processes.

4. Structural and Biophysical Analysis

This recombinant protein preparation appears suitable for structural biology approaches, including X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy studies of mouse Qpct. The high purity level likely meets the requirements for biophysical characterization techniques such as dynamic light scattering, differential scanning calorimetry, or analytical ultracentrifugation. Such analyses would provide insights into the three-dimensional structure, stability, and conformational properties of the mouse enzyme.

5. Comparative Species Studies and Evolutionary Analysis

The mouse-specific recombinant Qpct enables comparative biochemical studies with glutaminyl-peptide cyclotransferases from other species to understand evolutionary relationships and functional conservation. Researchers can perform side-by-side enzymatic assays, substrate preference analyses, and inhibitor sensitivity studies to identify species-specific differences. This application may be valuable for understanding how Qpct function has evolved across different mammalian species and for validating mouse models in research contexts.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue.
Gene References into Functions
  1. Authors identified a placenta-specific imprinted gene Qpct. Results show that Qpct is widely expressed during early embryonic development and can be detected in the telencephalon, midbrain, and rhombencephalon at E9.5-E11.5. PMID: 26447138
  2. co-regulation of the enzyme glutaminyl cyclase and its substrate TRH was reflected by a co-induction of both proteins in reactive astrocytes in proximity of Abeta deposits PMID: 25446989
  3. This study provide a thorough comparative characterization of the glutaminyl cyclases QC and isoQC in defined brain regions of different inbred and outbred mouse strains PMID: 24886834
  4. This study presents a first comparison of two mammalian QCs (mouse and human)containing typical, conserved post-translational modifications. PMID: 21671571
  5. Glutaminyl cyclase in a mouse knockout model has a role in hypothyroidism but not hypogonadism PMID: 21330373
  6. QC is crucial for modulating AbetapE3-42 levels in vivo and prove on a genetic base the concept that reduction of QC activity is a promising new therapeutic approach for AD. PMID: 21148560
  7. Murine isoQC proteins displayed a broad substrate specificity and preference for hydrophobic substrates, similar to the related QC. PMID: 19804409
  8. Results describe the expression of glutaminyl cyclase throughout the mouse brain during early postnatal development. PMID: 19699792
  9. The observations of this study indicated that brain ischemia might be a pathogenic factor of alzheimer disease through increasing BACE1, cathepsin B, and glutaminyl cyclase. PMID: 19809370
  10. QC is a zinc-dependent catalyst PMID: 16201766

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glutaminyl-peptide cyclotransferase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*