Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)


In Stock
Code CSB-MP019135MO
Product Type Recombinant Protein
Size US$1400Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q9CYK2
Lead Time 3-7 business days
Abbreviation Qpct
Relevance Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Glutaminyl cyclase Short name:QC
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
Research Area Neuroscience
Source Mammalian cell
Gene Names Qpct
Protein Names Recommended name: Glutaminyl-peptide cyclotransferase EC= 2.3.2.5 Alternative name(s): Glutaminyl cyclase Short name= QC Glutaminyl-tRNA cyclotransferase
Expression Region 36-362aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 41.6kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity).
Subcellular Location Secreted
Protein Families Glutaminyl-peptide cyclotransferase family
Database Links

KEGG: mmu:70536

STRING: 10090.ENSMUSP00000038732

UniGene: Mm.293870

Related Products

Qpct Antibodies

Qpct Antibodies for Mus musculus (Mouse)

Qpct Proteins

Qpct Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.