Recombinant Mouse Glycoprotein hormones alpha chain (Cga)

Code CSB-EP005293MO
Abbreviation Recombinant Mouse Cga protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Anterior pituitary glycoprotein hormones common subunit alpha;Follicle-stimulating hormone alpha chain;Follitropin alpha chain;Luteinizing hormone alpha chain;Lutropin alpha chain;Thyroid-stimulating hormone alpha chain;Thyrotropin alpha chain
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
25-120aa
Target Protein Sequence
LPDGDFIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.242.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH and follitropin/follicle stimulating hormone/FSH. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Gene References into Functions
  1. Data suggest that expression of Rps6ka5 in gonadotroph cell line is up-regulated by GnRH signaling and is required for Cga expression; GnRH-activates Rps6ka5 targets at the first nucleosome just downstream from the transcriptional start site. (Rps6ka5= mitogen and stress-activated protein kinase 1; GnRH = gonadotropin-releasing hormone; Cga = gonadotropin alpha subunit) PMID: 29054929
  2. TSH improves insulin sensitivity in skeletal muscle by increasing Irs1 gene expression. PMID: 27452800
  3. Oncogene-induced senescence is initiated in Braf(V600E)-induced papillary thyroid cancers when TSH is normal. TSH reduces p53 expression by upregulating the PI3K/AKT pathway and inhibiting OIS, resulting in tumor progression. PMID: 26477313
  4. the Cga eRNA mediates the physical interaction between genomic regions and determines the chromatin structure of the proximal promoter to allow gene expression PMID: 25810254
  5. Data suggest that highly bioactive luteinizing hormone (LH; both alpha [Cga] and beta [Lhb] subunits) is produced by embryo/blastocyst at time of implantation; LH bioactivity remains constant in blastocyst on days 5-10 after fertilization. PMID: 23464498
  6. Disruption of type II deiodinase in thyrotrophs decreases their sensitivity to T4 thyroid hormone and thus elevates serum TSH. PMID: 23524969
  7. We have identified a post-transcriptional regulatory network active during mouse pituitary development in which the expression of the hormone alphaGSU is increased by let7b/c through downregulation of KSRP PMID: 22844247
  8. results suggest that in alphaT3-1 cells, dopamine D(2) receptors negatively regulate pituitary gonadotropin alpha subunit gene expression in association with the cAMP-dependent pathway PMID: 12297539
  9. These results suggest that ADCYAP1 mainly increases Cga through activation of PKA and MAPK3/1, as well as through an additional unknown pathway. PMID: 17596563

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glycoprotein hormones subunit alpha family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*