Recombinant Mouse Group 10 secretory phospholipase A2 (Pla2g10)

In Stock
Code CSB-EP882554MO
Abbreviation Recombinant Mouse Pla2g10 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
Group X secretory phospholipase A2 (GX sPLA2) (sPLA2-X) (Phosphatidylcholine 2-acylhydrolase 10)
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
29-151aa
Target Protein Sequence
GLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYHHDCCYSRAQDAGCSPKLDRYPWKCMDHHILCGPAENKCQELLCRCDEELAYCLAGTEYHLKYLFFPSILCEKDSPKCN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant mouse Pla2g10 is generated in E. coli. The gene encoding the 29-151aa of the mouse Pla2g10 is co-inserted into an expression vector with an N-terminal 10xHis-tag and C-terminal Myc-tag gene and transformed into E. coli cells. These cells are grown and induced to produce the protein. The cells are lysed, and the protein is purified through affinity chromatography technique. Purity is assessed using SDS-PAGE, exceeding 85%.

PLA2G10 is an enzyme belonging to the secreted phospholipase A2 (sPLA2) family. PLA2G10 is highly expressed in the acrosome of male mouse sperm, indicating its role in sperm function [1]. PLA2G10 is associated with intestinal stem cell niche factors, inflammation, and cancer, where its expression levels were notably higher in specific populations [2]. Furthermore, PLA2G10 hydrolyzes phospholipids, showing a preference for certain types of fatty acids as substrates [3].

In the case of cancer, upregulation of PLA2G10 impairs T-cell infiltration, potentially dampening immunity [4]. This enzyme is related to sepsis because it catalyzes the hydrolysis of phospholipids, leading to the production of proinflammatory molecules [5].

References:
[1] R. Nahed, M. Dhellemmes, C. Payré, E. Blévec, J. Perrier, S. Hennebicqet al., Treatment of mouse sperm with a non-catalytic mutant of pla2g10 reveals that pla2g10 improves in vitro fertilization through both its enzymatic activity and as ligand of pla2r1, International Journal of Molecular Sciences, vol. 23, no. 14, p. 8033, 2022. https://doi.org/10.3390/ijms23148033
[2] M. Schewe, P. Franken, A. Sacchetti, M. Schmitt, R. Joosten, R. Böttcheret al., Secreted phospholipases a2 are intestinal stem cell niche factors with distinct roles in homeostasis, inflammation, and cancer, Cell Stem Cell, vol. 19, no. 1, p. 38-51, 2016. https://doi.org/10.1016/j.stem.2016.05.023
[3] S. Tokuoka, Y. Kita, M. Sato, T. Shimizu, Y. Yatomi, & Y. Oda, Development of tandem mass tag labeling method for lipid molecules containing carboxy and phosphate groups, and their stability in human serum, Metabolites, vol. 11, no. 1, p. 19, 2020. https://doi.org/10.3390/metabo11010019
[4] T. Zhang, Up-regulated pla2g10 in cancer impairs t cell infiltration to dampen immunity, Science Immunology, vol. 9, no. 94, 2024. https://doi.org/10.1126/sciimmunol.adh2334
[5] E. Berg, J. Paukovits, J. Axelband, J. Trager, D. Ryan, K. Cichonskiet al., Measurement of a novel biomarker, secretory phospholipase a2 group iia as a marker of sepsis: a pilot study, Journal of Emergencies Trauma and Shock, vol. 11, no. 2, p. 135, 2018. https://doi.org/10.4103/jets.jets_29_17

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids with preference for phosphatidylcholines and phosphatidylglycerols over phosphatidylethanolamines. Preferentially releases sn-2 omega-6 and omega-3 polyunsaturated fatty acyl (PUFA) chains over saturated fatty acyls. Contributes to phospholipid remodeling of very low-density lipoprotein (VLDL), low-density lipoprotein (LDL) and high-density lipoprotein (HDL) particles. Hydrolyzes LDL phospholipids releasing unsaturated fatty acids that regulate macrophage differentiation toward foam cells. Efficiently hydrolyzes and inactivates PAF, a potent lipid mediator present in oxidized LDL. May act in an autocrine and paracrine manner. Secreted by lung epithelium, targets membrane phospholipids of infiltrating eosinophils, releasing arachidonate and boosting eicosanoid and cysteinyl leukotriene synthesis involved in airway inflammatory response. Secreted by gut epithelium, hydrolyzes dietary and biliary phosphatidylcholines in the gastrointestinal lumen, thereby regulating adipogenesis and body weight. Plays a stem cell regulator role in colon epithelium. Within intracellular compartment, mediates Paneth-like cell differentiation and its stem cell supporting functions by inhibiting Wnt signaling pathway in intestinal stem cell (ISC). Secreted in the intestinal lumen upon inflammation, acts in an autocrine way and promotes prostaglandin E2 synthesis that stimulates the Wnt signaling pathway in ISCs and tissue regeneration. May participate in hair follicle morphogenesis by regulating phosphatidylethanolamines metabolism at the outermost epithelial layer and facilitating melanin synthesis. By generating lysophosphatidylcholines (LPCs) at sperm acrosome controls sperm cell capacitation, acrosome reaction and overall fertility. May promote neurite outgrowth in neuron fibers involved in nociception. Contributes to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Cleaves sn-2 fatty acyl chains of phosphatidylglycerols and phosphatidylethanolamines, which are major components of membrane phospholipids in bacteria. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane. In pulmonary epithelium, may contribute to host defense response against adenoviral infection. Prevents adenovirus entry into host cells by hydrolyzing host cell plasma membrane, releasing C16:0 LPCs that inhibit virus-mediated membrane fusion and viral infection. Likely prevents adenoviral entry into the endosomes of host cells. May play a role in maturation and activation of innate immune cells including macrophages, group 2 innate lymphoid cells and mast cells.
Gene References into Functions
  1. secretory PLA2s have important functions as genetic modifiers of inflammation and colon cancer. PMID: 27292189
  2. PLA2G10 releases omega-3 polyunsaturated fatty acids, suppresses colitis, and promotes sperm fertility. PMID: 26828067
  3. Progesterone-induced Acrosome Exocytosis Requires Sequential Involvement of Calcium-independent Phospholipase A2beta (iPLA2beta) and Group X Secreted Phospholipase A2 (sPLA2). PMID: 26655718
  4. GX sPLA2 negatively regulated pancreatic insulin secretion by augmenting COX-2-dependent PGE2 production. PMID: 25122761
  5. Mouse PLA2GX has a unique property of improving fertilization outcome among other secreted phospholipase A2 isoforms. PMID: 24287291
  6. Data indicate that experimental allergic bronchitis (EAB) in was associated with increased expression of sPLA2, specifically sPLA2gX, in the lungs. PMID: 24204651
  7. Authors propose that activation of GX-sPLA2 during H1N1pdm infection is an early step of pulmonary inflammation and its inhibition increases adaptive immunity and improves survival. PMID: 24725934
  8. Pla2G10 limits the development of atherosclerosis in LDL receptor-null mice. PMID: 23349189
  9. the use of a highly potent indole-based inhibitor of hGX-sPLA(2), RO061606 (which is ineffective against mGX-sPLA(2)), to assess the potential utility of GX-sPLA(2) blockade as a therapeutic intervention in asthma. PMID: 21652694
  10. sPLA(2)-X in neutrophils plays a pathogenic role in abdominal aortic aneurysms in a mouse model. PMID: 21984544
  11. sPLA2 plays a new role for fertilization by selecting a sperm subpopulation based on its effect on sperm motility. PMID: 21792918
  12. Group X secretory phospholipase A2 promotes macrophage inflammatory responses by altering cellular cholesterol homeostasis and lipid raft content. PMID: 21622863
  13. Physiological roles of group X-secreted phospholipase A2 in reproduction, gastrointestinal phospholipid digestion, and neuronal function. PMID: 21266581
  14. the spatiotemporal expression of sPLA(2)-X in hair follicles, the presence of skin-specific machinery leading to sPLA(2)-X activation, a functional link of sPLA(2)-X with hair follicle homeostasis. PMID: 21266583
  15. GX sPLA(2) promotes Ang II-induced pathological responses leading to abdominal aortic aneurysm formation PMID: 20833395
  16. hydrolytic products generated by GX sPLA(2) negatively regulate adipogenesis, possibly by suppressing LXR activation PMID: 20585029
  17. The overexpression of GX sPLA(2) significantly reduced ABCA1 and ABCG1 expression in J774 macrophage-like cells, whereas GX sPLA(2) deficiency in peritoneal macrophages was associated with enhanced expression. PMID: 20844270
  18. Group X phospholipase A2 is released during sperm acrosome reaction and controls fertility outcome in mice PMID: 20424324
  19. LDL modification by GXPLA2 [GXPLA2] PMID: 12021277
  20. group X secreted phospholipase A2 is expressed in neural cells and has neuritogenic action PMID: 15781456
  21. sPLA2-X induces potent arachidonic acid release without activation of cytosolic phospholipase A2 alpha. PMID: 15789617
  22. group V, but not group X, secreted phospholipase A2 has a role in lung dysfunction PMID: 17008322
  23. direct attention to group X-secreted phospholipase A2 as a novel therapeutic target for asthma PMID: 17403936
  24. Myocardial ischemia/reperfusion injury was attenuated in sPLA(2)-X(-/-) mice partly through the suppression of neutrophil cytotoxic activities PMID: 18506007
  25. secretory phospholipase A2 group X enhances anti-inflammatory responses, promotes lipid accumulation, and contributes to aberrant lung pathology PMID: 18511424
  26. Enhanced protein expression in mammalian cells using engineered SUMO fusions: example of secreted PLA2-X. PMID: 18539905

Show More

Hide All

Subcellular Location
Secreted. Lysosome. Cytoplasmic vesicle, secretory vesicle, acrosome.
Protein Families
Phospholipase A2 family
Tissue Specificity
Expressed at high levels in testis and the gastrointestinal tract including stomach and colon. Expressed at lower levels in other tissues including small intestine, uterus, oviduct, lung, thymus, spleen and brain. Expressed in Paneth-like secretory epithe
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*