Recombinant Mouse Growth/differentiation factor 5 (Gdf5)

Code CSB-EP009349MO
Abbreviation Recombinant Mouse Gdf5 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Gdf5; Bmp14; Bp; Gdf-5Growth/differentiation factor 5; GDF-5; Bone morphogenetic protein 14; BMP-14
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
376-495aa
Target Protein Sequence
APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with BMPR1A, leading to induction of SMAD1-SMAD5-SMAD8 complex phosphorylation and then SMAD protein signaling transduction. Secondly, negatively regulates chondrogenic differentiation through its interaction with NOG. Required to prevent excessive muscle loss upon denervation. This function requires SMAD4 and is mediated by phosphorylated SMAD1/5/8. Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes.
Gene References into Functions
  1. Microarray analysis of satellite cells showed that expression of growth differentiation factor 5 (Gdf5) mRNA was markedly increased in Dnmt3a-KO mice. The DNA methylation level of the Gdf5 promoter was markedly decreased in Dnmt3a-KO satellite cells. PMID: 29146735
  2. spatiotemporal dynamics of Gdf5 expression may instruct lineage divergence. PMID: 27292641
  3. he large array of modular enhancers for Gdf5 provide a new foundation for studying the spatial specificity of joint patterning in vertebrates, as well as new candidates for regulatory regions that may also influence osteoarthritis risk in human population PMID: 27902701
  4. Growth differentiation factor 5 is a novel target-derived factor that promotes sympathetic axon growth and branching and makes a distinctive regional contribution to the establishment of sympathetic innervation. PMID: 26878848
  5. Dach2 and Hdac9 mediate the effects of muscle activity on muscle reinnervation; Myog and Gdf5 appear to stimulate muscle reinnervation through parallel pathways PMID: 26483211
  6. Clonal expansion of Gdf5 progenitors contributes to linear growth of the enthesis. PMID: 26141957
  7. GDF5 might play a critical role in 3T3-L1 preadipocyte differentiation PMID: 25078108
  8. These results suggest that PI3K/Akt signals play a role in the GDF5-mediated brown adipogenesis through a mechanism related to activation of the Smad pathway. PMID: 24944017
  9. These results suggest that brown adipogenesis and energy homeostasis are both positively regulated by the GDF5/BMPR/Smad/PGC-1alpha signaling pathway in adipose tissues. PMID: 24062245
  10. apical and basal dendritic arbours of pyramidal cells throughout the hippocampus were stunted in both homozygous and heterozygous Gdf5 null mutants, indicating that dendrite size and complexity are sensitive to the level of endogenous GDF5 synthesis. PMID: 24173804
  11. This work implicates SOX11 as a potential regulator of GDF5 expression in joint maintenance and suggests a possible role in the pathogenesis of osteoarthritis PMID: 23356643
  12. A novel molecular mechanism of a GDF5 mutation affecting chondrogenesis and osteogenesis, is reported. PMID: 21976273
  13. Data show that revealed notochord cells in Gdf-5-null mice correctly form nuclei pulposi. PMID: 21278629
  14. Although GDF-5 deficiency did not compromise long-term fracture healing, a delay in cartilage formation and remodeling supports roles for GDF-5 in the early phase of bone repair. PMID: 21590487
  15. data suggest that decreased GDF5 levels in mice can contribute to osteoarthritis development by different mechanisms including altered loading and subchondral bone changes. PMID: 20805298
  16. potential target gene of HOXA13 PMID: 20034107
  17. These observations indicate that GDF-5 regulates differentiation of both dental papilla and follicle during odontogenesis, co-operatively with other growth factors such as BMP-2. PMID: 19909214
  18. GDF5 deficiency caused a 17% increase in medium diameter (100-225 nm) collagen fibrils in tail tendon, at the expense of larger fibrils. Thus, GDF5 may play a role in tendon homeostasis in mice. PMID: 11913489
  19. GDF-5-deficient femora were weaker (-31%) and more compliant (-57%) than controls when tested to failure in torsion. PMID: 11996912
  20. GDF-5 induced cell cycle arrest in the G1 phase before the appearance of apoptosis in mouse B cell hybridoma HS-72 cells PMID: 12464389
  21. role of single and double mutations in the mouse Gdf6 and Gdf5 genes in multiple joint and skeletal patterning defects PMID: 12606286
  22. GDF5 regulates expression of connexin 43 promoter in osteoblasts ans embryos PMID: 12881039
  23. GDF-5 may play an important role in modulating tendon repair. Data are consistent with previously posited roles for GDF-5 in cell recruitment, migration/adhesion, differentiation, proliferation, and angiogenesis. PMID: 12919870
  24. concordance between the mRNA expression profiles of GDF5 and the gap junction gene, Cx43, in the mouse embryonic limb, spine, and heart, consistent with coordinated functions for these gene products during developmental organogenesis PMID: 14613311
  25. GDF-5 synergistically enhances de novo bone formation capability of bone marrow mesenchymal cells in hyaluronan composites in rats. PMID: 14661262
  26. GDF5 has a role in growth of developing joints, including early joint interzones, adult articular cartilage, and the joint capsule PMID: 15492776
  27. Excessive apoptosis in the absence of GDF5 results in developmental failure of the phalanges. PMID: 15542031
  28. Deficiency in knockout mice affects biomechanical behavior and ultrastructure of mouse skin. PMID: 16112556
  29. Results describe 2 mutations in growth and differentiation factor 5 (GDF5) that alter receptor-binding affinities. PMID: 16127465
  30. Results suggest that CDMP1/GDF5 requires cleavage by two distinct proteolytic enzymes. PMID: 16829522
  31. Study further highlights a critical role of GDF5 in joint formation and the development of osteoarthritis (OA), and this should serve as a good model for OA. PMID: 17656374
  32. association of Gdf5-mediated signaling pathways with Trps1 and the phenotypic changes of ATDC5 cells due to over-expression or suppression of Trps1 PMID: 18363966
  33. Absence of GDF5 does not interfere with lipopolysaccharides toll-like receptor signaling in a mouse model of arthritis. PMID: 19604444

Show More

Hide All

Involvement in disease
Defects in Gdf5 are the cause of brachypodism (bp) which alters the length and numbers of bones in the limbs but spares the axial skeleton.
Subcellular Location
Secreted. Cell membrane.
Protein Families
TGF-beta family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*