Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Slc31a1

Uniprot No.

Q8K211

Research Area

Neuroscience

Alternative Names

Copper transporter 1;Solute carrier family 31 member 1

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-74aa

Target Protein Sequence

MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMMPMTFYFDFKNVNLLFSGLVINTPGE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

15.3 kDa

Protein Length

Partial of BC004372

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

High-affinity, saturable copper transporter involved in dietary copper uptake.

Gene References into Functions

Gene duplication and neo-functionalization in the evolutionary and functional divergence of the metazoan copper transporters Ctr1 and Ctr2 PMID: 28507097
studies identify a new processing event and the key protease that cleaves the Ctr1 metal-binding ectodomain, which functions to regulate cellular Cu(+) and cisplatin acquisition PMID: 27143361
CTR1, ATP7A, and lysyl oxidase were upregulated in the lung tissues and pulmonary arteries of mice with hypoxia-induced pulmonary hypertension and pulmonary arterial smooth muscle cells. PMID: 24614111
conclude that Y103 is required for the internalization of hCTR1 in response to Cu, that this occurs by a mechanism other than phosphorylation and that mutation of Y103 modulates the interaction with IRS-4 PMID: 24967972
A key regulatory mechanism for mammalian copper transport is through Ctr2-dependent accumulation of a Ctr1 variant lacking the copper- and cisplatin-binding ecto-domain. PMID: 24167251
conclude that Cu acquired from CTR1 is required for signaling in pathways regulated by RTKs that play major roles in development and cance PMID: 22842628
There was little difference in rates/kinetics of uptake of copper in the Ctr1+/+ and -/- cells. Endocytosis was not involved. PMID: 22354499
basal expression of Ctr1 is regulated by HIF2alpha; however, the induction by hypoxia is a HIF2alpha-independent event PMID: 22684009
Structure-functional organization of eukaryotic high-affinity copper importer CTR1 determines its ability to transport copper, silver and cisplatin PMID: 22670529
Data show apical localization of Ctr1 in intestinal epithelia and suggest that increased Ctr1 apical localization in response to dietary copper limitation may represent an adaptive response to modulate Ctr1 availability at the site of copper absorption. PMID: 20699218
Ctr1 is an important transport protein in the accumulation of silver in mammalian cells. PMID: 20569931
Mouse cell lines lacking one or both mouse Ctr1 (mCtr1) alleles exhibit increased cisplatin resistance and decreased cisplatin accumulation in parallel with mCtr1 gene dosage PMID: 12370430
These studies identify Ctr1 as the major factor driving intestinal Cu absorption in mammals. PMID: 16950140
These studies support a model in which vertebrate Ctr1 functions as a key regulator of the differentiation capacity of both stem and progenitor cell populations. PMID: 17620605
Deletion of hepatic Ctr1 reveals its function in copper acquisition and compensatory mechanisms for copper homeostasis. PMID: 19095764
Ctr1 is mainly localized on the basolateral side of both proximal and distal tubular cells in mouse kidneys. PMID: 19144690

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Note=Localizes to the apical membrane in intestinal epithelial cells.

Protein Families

Copper transporter (Ctr) (TC 1.A.56) family, SLC31A subfamily

Database Links

KEGG: mmu:20529

STRING: 10090.ENSMUSP00000081574

UniGene: Mm.248637

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP814304MO1
Abbreviation	Recombinant Mouse Slc31a1 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage