Recombinant Mouse Histone deacetylase 2 (Hdac2)

In Stock
Code CSB-EP010238MO
Abbreviation Recombinant Mouse Hdac2 protein
MSDS
Size $422
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
HD2;Protein deacylase HDAC2;YY1 transcription factor-binding protein
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-488aa
Target Protein Sequence
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVAKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDPKGAKSEQLSNP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.4 kDa
Protein Length
Full Length
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Forms transcriptional repressor complexes by associating with MAD, SIN3, YY1 and N-COR. Interacts in the late S-phase of DNA-replication with DNMT1 in the other transcriptional repressor complex composed of DNMT1, DMAP1, PCNA, CAF1. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. May be involved in the transcriptional repression of circadian target genes, such as PER1, mediated by CRY1 through histone deacetylation. Involved in MTA1-mediated transcriptional corepression of TFF1 and CDKN1A.
Gene References into Functions
  1. The results suggest that the interaction between Zeb1, Hdac2, and eNOS is required for early mesendodermal differentiation of naive mouse embryonic stem cells. PMID: 29599503
  2. Hdac1 and Hdac2 as regulators of microglia activation, proliferation, and phagocytosis that define microglia features during the specific conditions of prenatal development and AD-associated neurodegeneration. In contrast, we found that deficiency of Hdac1 and Hdac2 in neuroectodermal cells was not able to modulate amyloid plaque formation. PMID: 29548672
  3. An early response to nerve injury has been identified that controlled by HDAC2, which coordinates the action of other chromatin remodeling enzymes to induce the upregulation of Oct6, a key transcription factor for Schwann cells development. PMID: 28139683
  4. The activity of HDAC2 and HDAC8 was elevated 7 days after the ischemia both in neurons and astrocytes of the studied brain structures. PMID: 29218547
  5. miR-455-3p activated Nrf2/ARE signal pathway through suppressing Keap1 via negative regulating HDAC2 protein level, thereby suppressing oxidative stress and promoting osteoblasts growth. PMID: 29042277
  6. results show that Hdac1 and Hdac2 function redundantly within the neural crest to regulate proliferation and the development of the pharyngeal arches by means of repression of cyclin-dependent kinase inhibitors. PMID: 28791750
  7. The E26 transformation-specific transcription factor, ETV4, which is induced by fibroblast growth factor signalling and acts as a repressor of ZRS activity, interacts with the histone deacetylase HDAC2 and ensures that the poised ZRS remains transcriptionally inactive. PMID: 28949289
  8. In the delayed phase after stroke, administration of HDAC2 inhibitors promoted functional recovery via epigenetically increased neuroplasticity-related genes expression leading to circuit reorganization in the peri-infarct area. PMID: 28982677
  9. Hdac2 silencing in pregnant mice elevated placental P-gp expression and decreased digoxin transplacental transfer rate. PMID: 28962688
  10. the epigenetic regulators HDAC1 and HDAC2 control nephrogenesis via interactions with the transcriptional programs of nephron progenitors and renal vesicles. PMID: 29712641
  11. these findings suggested that HDAC2 may be an important negative regulator involved in chronic stressinduced cognitive impairment. PMID: 28656275
  12. Study demonstrated that in the mouse liver, HDAC2 is primarily expressed in hepatocytes. CD36 deletion inhibited nuclear expression of HDAC2 in hepatocytes but had no impact on the expression of HDAC2 in macrophages. PMID: 27967209
  13. miR-223 controls the expression of CX3CL1 by targeting HDAC2 in chronic obstructive pulmonary disease patients and mouse models of the disease. PMID: 26864305
  14. Members of the SIN3A/HDAC2 corepressor complex are enriched in an extended NANOG interactome. PMID: 28199843
  15. The findings suggest that miR-455-3p plays a critical role during chondrogenesis by directly targeting HDAC2/8 and promoting histone H3 acetylation. PMID: 27638301
  16. Treatment of the haplotype Npr1(+/-) mice with histone deacetylase inhibitors significantly lowered blood pressure and reduced the renal inflammation and fibrosis involving the interactive roles of HDAC1/2, NF-kappaB (p65), and STAT1. PMID: 28566502
  17. Acetylation-dependent control of global poly(A) RNA degradation by CBP/p300 and HDAC1-HDAC2 has been described. PMID: 27635759
  18. Our study indicates that ischemia-induced histone deacetylase 2 upregulation from 5 to 7 d after stroke mediates the secondary functional loss by reducing survival and neuroplasticity of peri-infarct neurons as well as augmenting neuroinflammation. Thus, precisely targeting histone deacetylase 2 in the window phase provides a novel therapeutic strategy for stroke recovery. PMID: 28592694
  19. Taken together, Fam60a is an essential core subunit of a variant Sin3a-Hdac complex in embryonic stem cells that is required to promote rapid proliferation and prevent unscheduled differentiation. PMID: 28554894
  20. provide new insight into the upstream regulation of Sap90/Psd95-associated protein 3 and establish the essential role of striatal Hdac1, Hdac2 and MeCP2 for suppression of repetitive behaviors PMID: 27668390
  21. this study shows that infection-induced miR-21 promotes severe, steroid-insensitive allergic airway disease by suppressing HDAC2 PMID: 27448447
  22. observations suggest that Methamphetamine may induce large-scale transcriptional changes in the Nuc. Accumbens by regulating the expression of several histone deacetylases in part, via HDAC2-dependent mechanisms. PMID: 26721795
  23. We also found that glucocorticoid receptor (GR)-mediated histone deacetylase 2 (HDAC) 2 expression and activity are reduced in the Trpv1(-/-) mice and that HDAC2-regulated, cell-cycle- and neuroplasticity-related molecules are altered PMID: 28402861
  24. CRISPR/Cas9-mediated disruption of the Hdac2 gene increased Slc2a1 expression, suggesting that it is one of the responsible histone deacetylases (HDACs). These results confirm that b-OHB is a HDAC inhibitor and show that b-OHB plays an important role in fasting-induced epigenetic activation of a glucose transporter gene in the brain. PMID: 27935189
  25. Data suggest that pathological cardiac hypertrophy involved class I histone deacetylases HDAC1 and HdAC2, tuberous sclerosis complex 2 (TSC2), and mTOR srine-threonine kinases (mTOR). PMID: 27048565
  26. Social isolation resulted in down-regulation of Hdac2 mRNA expression in the cerebral cortex. PMID: 26921097
  27. Injecting these oocytes with Hdac2 partially restores DNMT3A2 nuclear staining. PMID: 26586441
  28. Our data show that: i) HDAC2 levels and activity are increased in NPC neuronal models and in Npc1(-/-) mice; ii) inhibition of c-Abl or c-Abl deficiency prevents the increase of HDAC2 protein levels and activity in NPC neuronal models PMID: 26603102
  29. This study reveals a dominant negative effect of catalytically inactive HDAC2 on specific corepressor complexes resulting in histone hyperacetylation, transcriptional derepression, and, ultimately, perinatal lethality. PMID: 26598605
  30. This study demonstrated that hdac2 increase in skeletal muscle in muscle atrophy. PMID: 26372908
  31. Intestinal epithelial cell (IEC) determination and intestinal homeostasis are highly dependent on Hdac1 and Hdac2 activity levels, and changes in the IEC acetylome may alter the mucosal environment. PMID: 26174178
  32. results demonstrate that combined HDAC1 and HDAC2 ablation promotes survival of axotomized retinal ganglion cells; HDAC1/2 ablation inhibited the apoptotic pathway by impairing acetylation status of p53 and reducing PUMA expression, thereby contributing to the ensuing enhanced neuroprotection due to HDAC1/2 depletion PMID: 26129908
  33. Scopolamine induced memory impairment along with increased gene expression of HDAC2 in corpus striatum. PMID: 25982413
  34. mechanistic evidence for the gene-specific transcription repression activity of Tet2 via histone deacetylation and for the prevention of constant transcription activation at the chromatin level for resolving inflammation PMID: 26287468
  35. HDAC2 might be a downstream effector of Jak2 to mediate cardiac hypertrophic response by pressure overload or Ang-II. PMID: 25380525
  36. Hdac1 and Hdac2 are crucial for kidney development, regulating Wnt and p53 pathways in the ureteric bud epithelium. PMID: 25758227
  37. Report role of myocardial mSin3A/HDAC1/2 complex in mediating the beneficial effects of exercise in diabetic cardiomyopathy. PMID: 23835259
  38. Our study reveals the novel regulation of FOXO3a-mediated selective gene transcription via HDAC2 epigenetic modification in the process of oxidative stress-induced cell death PMID: 25609639
  39. HDAC2 mRNA and protein expression increased in the hippocampus of old male mice as compared to young and adult PMID: 24924148
  40. 5-FU acutely induces the severe myelin degeneration in adolescence and disruption of TCF7L2/HDAC1/HDAC2 complex is at least partially involved in 5-FU-induced demyelination. PMID: 25178657
  41. HDAC1, HDAC2, and HDAC3 bind at RAREs in the Hoxa1 and Cyp26a1 gene regulatory regions PMID: 24821725
  42. data indicate that HDAC1/2 have essential and pleiotropic roles in cellular proliferation and regulate stem cell self-renewal by maintaining expression of key pluripotent transcription factors PMID: 24958871
  43. controls differentiation and lineage commitment of CD4 and CD8-positive T-lymphocytes PMID: 24681565
  44. Findings suggest that epithelial histone deacetylases HDAC1 and HDAC2 restrain the intestinal inflammatory response, and regulate intestinal epithelial cell proliferation and differentiation. PMID: 24040068
  45. HDAC2-dependent deacetylation of MORF4L1 enhances MORF4L1 homodimerization, thus facilitating the functionality of complex formation to repress cell proliferation. PMID: 24451372
  46. by controlling the expression of Pax3 and the concerted action of Pax3 and Sox10 on their target genes, HDAC1/2 direct the specification of neural crest cells into peripheral glia. PMID: 24760871
  47. Hdac1 and Hdac2 are essential intestinal epithelial cell homeostasis regulators. PMID: 24525021
  48. these findings suggest that altered levels of epigenetic regulatory proteins including HDAC2 regulate age-related changes in the mouse hippocampus and that caloric restriction may prevent these age-related changes. PMID: 24093534
  49. Results identify histone deacetylase 2 as an important regulator, mediating chromatin condensation and enucleation in the final stages of mammalian erythropoiesis. PMID: 20823130
  50. Primary macrophages rely on histone deacetylase 1 and 2 expression to induce type I interferon in response to gammaherpesvirus infection. PMID: 24335310

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
Histone deacetylase family, HD type 1 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*