Recombinant Mouse Homeobox protein Nkx-2.2 (Nkx2-2)

Code CSB-EP015842MO
Abbreviation Recombinant Mouse Nkx2-2 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Nkx2-2
Uniprot No.
Research Area
Others
Alternative Names
Nkx2-2; Nkx-2.2; Nkx2b; Homeobox protein Nkx-2.2; Homeobox protein NK-2 homolog B
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-273aa
Target Protein Sequence
MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional activator involved in the development of insulin-producting beta cells in the endocrine pancreas. May also be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Binds to elements within the NEUROD1 promoter.
Gene References into Functions
  1. The transient hypoxia at P7 altered the expression of Nkx2.2, resulting in delayed myelination in the external capsule. PMID: 28546087
  2. This suggests that Nkx2.2 is not only required in the early pancreatic progenitors, but has additional essential activities within the endocrine progenitor population. PMID: 28071588
  3. Lmx1a is expressed in enterochromaffin cells and functions downstream of Nkx2.2. PMID: 27287799
  4. nuclear import of Nkx2-2 is mediated not only by the classical import pathway but also directly by imp beta1 or imp 13 PMID: 27956177
  5. Demonstrate that a rare mature enteroendocrine cell subpopulation that is demarcated by Nkx2.2 expression display stem cell properties during normal intestinal epithelial homeostasis, but is not easily activated upon injury. PMID: 26492922
  6. that Nkx2.2 and Nkx2.9 proteins play no role in the development of branchiovisceral motor neurons in hindbrain rostral to rhombomere 4. PMID: 25919494
  7. These data identify Nkx2.2 as key regulator to determine neuronal subtypes in the p3 domain of the central nervous system. PMID: 25840610
  8. The study demonstrates a previously unrecognized mechanism that controls insulin expression through c-Abl-regulated NKx2.2 and GLUT2. PMID: 24835010
  9. Our studies reveal that a subset of mouse perineurial cells are CNS-derived, express Nkx2.2, and are essential for motor nerve development. PMID: 24979729
  10. NKX2-2 and MNX1 are etiological genes for neonatal diabetes. PMID: 24411943
  11. Nato3 induces ectopic Foxa2-positive cells and indirectly downregulates Nkx2.2 expression. PMID: 24401371
  12. Nkx2.2 functions as a major 'switch' to turn off Pdgfra signaling in oligodendrocyte precursor cells and initiate the intrinsic program for oligodendrocyte differentiation. PMID: 24449836
  13. Sirt2 enhances CG4 oligodendroglial differentiation and report a novel mechanism through which Nkx2.2 represses CG4 oligodendroglial differentiation via Sirt2. PMID: 21669943
  14. The NKX2-2 can induce desired neuronal lineages from most expressing neural progenitor cells by a mechanism resembling developmental binary cell-fate switching. PMID: 21624811
  15. Nkx2.2 acts by reinforcing the transcriptional networks initiated by Pax4 and Arx in early committed beta- and alpha-cell, respectively. PMID: 21880149
  16. Mutation of the endogenous Nkx2.2 tinman (TN) domain in mice abolishes the interaction between Nkx2.2 and Grg3 and disrupts beta-cell specification PMID: 22056672
  17. these experiments identify novel genetic interactions between Nkx2.2 and Arx within the endocrine progenitor cells that ensure the correct specification and regulation of endocrine hormone-producing cells PMID: 21856296
  18. sonic hedgehog-GLI1 downstream target genes PTCH1, Cyclin D2, Plakoglobin, PAX6 and NKX2.2 are differently regulated in medulloblastoma and astrocytoma PMID: 21059263
  19. Data argue that the Nkx2.2 and Nkx2.9 transcription factors contribute crucially to the formation of neuronal networks that function as central pattern generators for locomotor activity in the spinal cord. PMID: 21068056
  20. Nkx2.2 can bind to ghrelin promoter;results suggest upregulation of ghrelin in Nkx2.2 null mice is not due to loss of repression of ghrelin promoter in nonghrelin islet cells; Nkx2.2 may contribute to activation of ghrelin in mature islet epsilon-cells PMID: 19965928
  21. co-expression of Nkx2.2 and Nkx6.2 transcription factors in myelinating oligodendrocytes suggests their functional interactions in the regulation of myelin sheath formation and/or maintenance PMID: 19780200
  22. Expression profiling of Nkx2.2-/- mice during embryogenesis has allowed identification of known and novel pancreatic genes that function downstream of Nkx2.2 to regulate pancreas development. PMID: 20003319
  23. regulates expression of genes selectively expressed in islet beta cells PMID: 12426319
  24. role of Pax4 appears to be accomplished via its genetic interaction with another homeobox gene, Nkx2.2 PMID: 14729487
  25. Nkx2.2 and Pax4 are required to specify or maintain differentiation of the beta cell fate. PMID: 14970313
  26. Data show that FoxA2, Nkx2.2, and PDX-1 regulate islet beta-cell-specific mafA expression through conserved sequences located between base pairs -8118 and -7750 upstream from the transcription start site. PMID: 16847327
  27. The control of oligodendrocyte differentiation by Olig2, Sox10 and Nkx2.2 is a dosage-dependent developmental process and can be affected by both haploinsufficiency and over-dosage. PMID: 17098222
  28. Nkx2.2 functions predominantly as a transcriptional repressor during specification of endocrine cell types in the pancreas. PMID: 17202186
  29. indicate a previously undiscovered role for Nkx2.2 in the maintenance of mature beta-cell function and the formation of normal islet structure PMID: 17456846
  30. These studies identify a novel role for Nkx2.2 in intestinal endocrine cell development and reveal the regulatory similarities between cell type specification in the pancreatic islet and in the enteroendocrine population of the intestine. PMID: 18022152
  31. During development, Phox2b and Nkx2.2 form a non-cell-autonomous feedback loop that links the neural crest with the pancreatic epithelium, and regulates the size of the beta-cell population. PMID: 18506029
  32. These results together imply that Nkx2.2 antisense RNA has a certain biological function which is likely to be not only based on the affect on transcription level of Nkx2.2 coding gene in cis, but also on the other mechanisms. PMID: 18538132
  33. NKX2.2 functions in immature endocrine cells to control neuroendocrine differentiation in normal intestine and is expressed in most neuroendocrine tumors of the gut PMID: 18987169
  34. These data provide important insights into specific functions of PAX6 and NKX2.2 during glial cell specification that have so far remained largely unexplored. PMID: 19258013

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
NK-2 homeobox family
Tissue Specificity
Expressed in restricted areas of the developing CNS: the hindbrain and forebrain, and pancreas.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*