Recombinant Mouse Interferon regulatory factor 8 (Irf8)

In Stock
Code CSB-EP011823MO
Abbreviation Recombinant Mouse Irf8 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Irf8; Icsbp; Icsbp1; Interferon regulatory factor 8; IRF-8; Interferon consensus sequence-binding protein; ICSBP
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-424aa
Target Protein Sequence
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLPDSRVVLCFGEEFPDTVPLRSKLILVQVEQLYARQLVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQQITV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Interferon regulatory factor 8 (Irf8) is produced in E. coli and includes the complete protein sequence from amino acids 1 to 424. The protein carries an N-terminal 6xHis-SUMO tag that appears to improve both solubility and purification efficiency, reaching purity levels above 90% when verified through SDS-PAGE analysis. This high-quality recombinant protein is intended strictly for research purposes and may support a range of experimental applications.

Interferon regulatory factor 8 (Irf8) seems to play a central role in immune responses, particularly in controlling genes linked to immune cell differentiation and function. This transcription factor is likely crucial for modulating pathways in hematopoietic cells. Its influence on macrophage and dendritic cell development and function makes Irf8 activity essential for understanding immune regulation, with potentially significant implications for immunological research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Irf8 is a transcription factor that requires precise folding of its DNA-binding domain (N-terminal) and protein-interaction domains (C-terminal) for function. While the SUMO tag may improve solubility in E. coli, transcription factors often require specific chaperones and post-translational modifications for proper folding that bacterial systems cannot provide. The full-length protein (424aa) is complex, and the probability of correct folding for all functional domains is low. DNA-binding and protein-interaction activities cannot be assumed without validation.

1. Antibody Development and Validation

This recombinant Irf8 serves as an excellent immunogen for generating antibodies against linear epitopes. The full-length sequence ensures comprehensive coverage. The high purity minimizes antibodies against contaminants. However, antibodies may not efficiently recognize conformational epitopes on the native transcription factor.

2. Biochemical Characterization and Stability Studies

This is the essential first step to assess the protein's physical properties. Techniques like size-exclusion chromatography can determine oligomeric state and homogeneity, while circular dichroism can analyze secondary structure content and thermal stability. These studies provide critical quality control data. These analyses provide crucial data for understanding the protein's properties (not the native protein) and informing its use in other applications.

3. Tag-Based Purification Method Development

This protein is ideal for optimizing His-SUMO tag purification protocols, including testing SUMO protease cleavage efficiency and developing standardized purification workflows for related transcription factors. The well-defined protein allows systematic testing of buffer conditions and chromatography parameters.

Final Recommendation & Action Plan

The E. coli expression system is poorly suited for producing a functional full-length transcription factor like Irf8, limiting its applications to non-functional uses. The immediate priority is Application 2 (Biochemical Characterization) to assess the protein's folding state and stability. Applications 1 and 3 (Antibody Development and Purification Optimization) can proceed confidently as they don't require functional activity. Transcription factor interactions require precise tertiary structure. For functional Irf8 studies, use proteins expressed in eukaryotic systems or investigate endogenous Irf8 from cellular contexts.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription factor that specifically binds to the upstream regulatory region of type I interferon (IFN) and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Can both act as a transcriptional activator or repressor. Plays a negative regulatory role in cells of the immune system. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes. Required for the development of plasmacytoid dendritic cells (pDCs), which produce most of the type I IFN in response to viral infection. Positively regulates macroautophagy in dendritic cells.
Gene References into Functions
  1. breast and pancreatic tumor-produced granulocyte-stimulating factor downregulates interferon regulatory factor-8 in conventional dendritic cells (cDC) progenitors, and thus results in reduced cDC1 development PMID: 29593283
  2. Study shows that IRF8 is required for Th9 differentiation in vitro and in vivo. IRF8 functions through a transcription factor complex consisting of IRF8, IRF4, PU.1 and BATF, which binds to DNA and boosts Il9 transcription. PMID: 29233972
  3. Expression of IRF-8 is significantly elevated in the microglia of AD mice. Silencing of IRF-8 abolished Abeta1-40-induced microglia activation. PMID: 28856571
  4. DNA methylation plays a protective role in cisplatin-induced acute kidney injury by regulating specific genes, such as Irf8. PMID: 28709638
  5. IRF8 does not play an essential intrinsic role in Th17 cell differentiation. PMID: 27140932
  6. frequencies of antigen-experienced CD4+CD11ahiCD49dhi cells that were CD44hiCD62L- were similar in MLN of infected Irf8-/- and B6 mice, but the proportions of CD4+GATA3+ and CD4+IL-4+ T cells were lower in infected Irf8-/- mice PMID: 28968468
  7. Mysm1 enhanced function of the IRF2 and IRF8 promoters, suggesting that Mysm1 governs the IRFs for hematopoietic stem cell homeostasis. PMID: 27277682
  8. results show that polymorphonuclear-myeloid-derived suppressor cells arise from a newly defined granulocyte progenitors (GP) stage within the bone marrow and that IRF8 levels (and/or their downstream target genes) in those GPs guide their expansion or contraction PMID: 28356386
  9. IRF8 differentially controls the survival. PMID: 27637148
  10. IRF8 might play a role in restraining excess lymphocyte proliferation. PMID: 27171004
  11. IRF8 controls Th1 immune response in Treg cells independent of T-bet. PMID: 26166768
  12. The authors further identified a distinct molecular signature of F4/80(hi) and CD11b(hi) macrophages and found that Irf8 was vital for macrophage maturation. PMID: 27412700
  13. this study shows that myeloid-specific SIRT1 restrains pro-inflammatory processes by deacetylating IRF8 PMID: 28008797
  14. IRF8 was a target of miR-451a in vitro and in vivo. The data indicate the function and a target of miR-451a in SLE PMID: 28120198
  15. the mechanism for the observed differential induction of the mouse Ifit1, Ifit2, and Ifit3 genes in B cells and demonstrated that the repressive effect of the transcription factor interferon regulatory factor 8 (IRF8), which is highly expressed in B cells, played an essential role in this regulation. PMID: 27137933
  16. direct the expression of a set of genes, the IRF8/IRF1 regulome, that play critical roles in host inflammatory and antimicrobial defenses in mouse models of neuroinflammation and of pulmonary tuberculosis, respectively PMID: 27001747
  17. we identified IRF8 target genes in gastric epithelial cells, providing a detailed understanding of how IRF8 functions in gastric mucosal innate immunity PMID: 26843324
  18. results suggest that impaired Icsbp expression enhances leukemogenesis by deregulating processes that normally limit granulocyte expansion during the innate immune response. PMID: 26683374
  19. variation in IRF4 or IRF8 levels resulting from genetic polymorphisms or environmental cues will govern tissue dendritic cells numbers and regulate the magnitude of their functional responses. PMID: 26746189
  20. It plays a crucial role in the transformation of microglia to a reactive state by regulating the expression of various genes. PMID: 26318672
  21. Data indicate that interferon regulatory factor-8 (IRF8) regulates tumor behavior in an matrix metalloproteinase 3 (MMP3)-dependent manner. PMID: 26008967
  22. Data indicate that interferon regulatory factors IRF4 and IRF8 control distinct activated B cell states. PMID: 26437243
  23. dendritic cells from mice with CD11c-specific constitutive b-catenin activation upregulated IRF8 through targeting of the Irf8 promoter, leading to in vivo expansion of IRF8-dependent CD8alpha+, plasmacytoid, and CD103+ CD11b2 dendritic cells. PMID: 25416805
  24. Loss of IRF8 in T Cells Exacerbates Uveitis, Whereas Irf8 Deletion in the Retina Confers Protection PMID: 26163590
  25. Data show that IRF8 directly interacts with NFATc1 to prevent NFATc1 translocation and thus inhibits the hypertrophic response. PMID: 24526256
  26. we concluded that the IRF-8 KO cells performed pure uncorrelated random walks, while WT splenocytes were able to make singular drifted random walks that collapsed on a straight ballistic motion for the system as a whole PMID: 25322144
  27. IRF5 expression in microglia is regulated by IRF8. IRF5 directly upregulates P2rX4 expression on microglia in peripheral nerve injury, and may play a role in neuropathic pain. PMID: 24818655
  28. Data indicte that interferon regulatory factor 8 (IRF8) expression becomes dependent on transcription factor Batf3. PMID: 26054719
  29. These data highlight a critical role for IRF8 in inflammatory monocyte differentiation and migration during WNV infection. PMID: 25277331
  30. IRF8 is a major autophagy regulator in macrophages, essential for macrophage maturation, survival and innate immune responses PMID: 25775030
  31. plays a key role in the cross-talk between melanoma and immune cells delimiting tumor spread PMID: 24597645
  32. Irf8-knockout microglia exhibited a differential expression pattern of nucleotide-degrading enzymes compared to their wild-type counterparts. PMID: 24798612
  33. Basal IRF8-PU.1 binding maintained the expression of a broad panel of genes essential for macrophage functions (such as microbial recognition and response to purines) and contributed to basal expression of many LPS-inducible genes PMID: 25637355
  34. we demonstrate that interferon regulatory factor-8 regulates basophil and mast cell development PMID: 25398936
  35. The transcription factors IRF8 and PU.1 negatively regulate plasma cell differentiation. PMID: 25288399
  36. The overexpressed IRF8 can effectively inhibit the differentiation of RAW264.7 cells into osteoclast-like cells. PMID: 24606735
  37. we found that the transcriptional factor IRF8 plays a protective role in the cerebral ischaemic-reperfusion injury by attenuating neuronal apoptosis PMID: 24528256
  38. IRF8 enhanced alphavbeta8 integrin expression in APCs and activated TGF-beta signaling leading to T helper 17 (Th17) cell differentiation PMID: 24485804
  39. Data indicate that interferon regulatory factor 8 (IRF8) inhibited smooth muscle cells (SMCs) marker gene expression through regulating serum response factor (SRF) transactivation in a myocardin-dependent manner. PMID: 24248596
  40. Data from mutant/knockout mice suggest that Irf8 is involved in innate immunity against Plasmodium berghei cerebral malaria; neuronal gene expression up-regulated by Plasmodium berghei infection favors proteins with IRF8 binding sites. PMID: 23853600
  41. IRF-8 is an essential factor for the maintenance of proper immune cell recruitment in granulomas. PMID: 23717393
  42. IRF8-deficient mice produced anti-dsDNA Abs. In a double-transgenic model, B cell anergy was breached in IRF8-deficient mice. Anergic B cells in the IRF8-deficient background were able to mature further & regain responses to Ag stimulation. PMID: 24218455
  43. Irf8 expression in DC9 cells led to an increase in Id2 & Batf3 transcript levels. Without it, Id2 & Batf3 expression was insufficient for directing classical CD8alpha(+) DC development. PMID: 24227775
  44. IRF8-rescued BCR-ABL-expressing dendritic cells were capable of inducing CTLs more efficiently than control dendritic cells. IRF8 is an attractive target in next-generation therapies for chronic myelogenous leukemia. PMID: 24242069
  45. These results suggest a central role for IFN regulatory factor 8-expressing CD8(+) DCs in governing the TLR11- and TLR12-mediated host defense against Toxoplasma gondii. PMID: 24078692
  46. Irf8 Expression Is Required for Transcriptional Identity of Early DC Progenitors. PMID: 23623495
  47. Irf8-deficient mice generate myeloid populations highly homologous to tumor-induced myeloid-derived suppressor cells. PMID: 24091328
  48. MiR-22 binds directly to the 3'UTR of the mouse Irf8 mRNA. PMID: 23251709
  49. Data indicate that Bcr-abl increases PTPN13 promoter activity in an Icsbp-dependent manner. PMID: 22891763
  50. these results underscore a key role of IRF-8 in the cross talk between melanoma and immune cells, thus revealing its critical function within the tumor microenvironment in regulating melanoma progression and invasiveness. PMID: 23308054

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
IRF family
Tissue Specificity
Mainly expressed in lymphoid tissues. Predominantly expressed in CD8(+)-expressing dendritic cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*