Recombinant Mouse Interferon regulatory factor 8(Irf8)

Code CSB-EP011823MO
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Irf8
Uniprot No. P23611
Research Area Others
Alternative Names Irf8; Icsbp; Icsbp1; Interferon regulatory factor 8; IRF-8; Interferon consensus sequence-binding protein; ICSBP
Species Mus musculus (Mouse)
Source E.coli
Expression Region 1-424aa
Target Protein Sequence MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLPDSRVVLCFGEEFPDTVPLRSKLILVQVEQLYARQLVEEAGKSCGAGSLMPALEEPQPDQAFRMFPDICTSHQRPFFRENQQITV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 64.2kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Plays a role as a transcriptional activator or repressor (By similarity). Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a negative regulatory role in cells of the immune system. Involved in CD8(+) dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes
Gene References into Functions
  1. breast and pancreatic tumor-produced granulocyte-stimulating factor downregulates interferon regulatory factor-8 in conventional dendritic cells (cDC) progenitors, and thus results in reduced cDC1 development PMID: 29593283
  2. Study shows that IRF8 is required for Th9 differentiation in vitro and in vivo. IRF8 functions through a transcription factor complex consisting of IRF8, IRF4, PU.1 and BATF, which binds to DNA and boosts Il9 transcription. PMID: 29233972
  3. Expression of IRF-8 is significantly elevated in the microglia of AD mice. Silencing of IRF-8 abolished Abeta1-40-induced microglia activation. PMID: 28856571
  4. DNA methylation plays a protective role in cisplatin-induced acute kidney injury by regulating specific genes, such as Irf8. PMID: 28709638
  5. IRF8 does not play an essential intrinsic role in Th17 cell differentiation. PMID: 27140932
  6. frequencies of antigen-experienced CD4+CD11ahiCD49dhi cells that were CD44hiCD62L- were similar in MLN of infected Irf8-/- and B6 mice, but the proportions of CD4+GATA3+ and CD4+IL-4+ T cells were lower in infected Irf8-/- mice PMID: 28968468
  7. Mysm1 enhanced function of the IRF2 and IRF8 promoters, suggesting that Mysm1 governs the IRFs for hematopoietic stem cell homeostasis. PMID: 27277682
  8. results show that polymorphonuclear-myeloid-derived suppressor cells arise from a newly defined granulocyte progenitors (GP) stage within the bone marrow and that IRF8 levels (and/or their downstream target genes) in those GPs guide their expansion or contraction PMID: 28356386
  9. IRF8 differentially controls the survival. PMID: 27637148
  10. IRF8 might play a role in restraining excess lymphocyte proliferation. PMID: 27171004
  11. IRF8 controls Th1 immune response in Treg cells independent of T-bet. PMID: 26166768
  12. The authors further identified a distinct molecular signature of F4/80(hi) and CD11b(hi) macrophages and found that Irf8 was vital for macrophage maturation. PMID: 27412700
  13. this study shows that myeloid-specific SIRT1 restrains pro-inflammatory processes by deacetylating IRF8 PMID: 28008797
  14. IRF8 was a target of miR-451a in vitro and in vivo. The data indicate the function and a target of miR-451a in SLE PMID: 28120198
  15. the mechanism for the observed differential induction of the mouse Ifit1, Ifit2, and Ifit3 genes in B cells and demonstrated that the repressive effect of the transcription factor interferon regulatory factor 8 (IRF8), which is highly expressed in B cells, played an essential role in this regulation. PMID: 27137933
  16. direct the expression of a set of genes, the IRF8/IRF1 regulome, that play critical roles in host inflammatory and antimicrobial defenses in mouse models of neuroinflammation and of pulmonary tuberculosis, respectively PMID: 27001747
  17. we identified IRF8 target genes in gastric epithelial cells, providing a detailed understanding of how IRF8 functions in gastric mucosal innate immunity PMID: 26843324
  18. results suggest that impaired Icsbp expression enhances leukemogenesis by deregulating processes that normally limit granulocyte expansion during the innate immune response. PMID: 26683374
  19. variation in IRF4 or IRF8 levels resulting from genetic polymorphisms or environmental cues will govern tissue dendritic cells numbers and regulate the magnitude of their functional responses. PMID: 26746189
  20. It plays a crucial role in the transformation of microglia to a reactive state by regulating the expression of various genes. PMID: 26318672
  21. Data indicate that interferon regulatory factor-8 (IRF8) regulates tumor behavior in an matrix metalloproteinase 3 (MMP3)-dependent manner. PMID: 26008967
  22. Data indicate that interferon regulatory factors IRF4 and IRF8 control distinct activated B cell states. PMID: 26437243
  23. dendritic cells from mice with CD11c-specific constitutive b-catenin activation upregulated IRF8 through targeting of the Irf8 promoter, leading to in vivo expansion of IRF8-dependent CD8alpha+, plasmacytoid, and CD103+ CD11b2 dendritic cells. PMID: 25416805
  24. Loss of IRF8 in T Cells Exacerbates Uveitis, Whereas Irf8 Deletion in the Retina Confers Protection PMID: 26163590
  25. Data show that IRF8 directly interacts with NFATc1 to prevent NFATc1 translocation and thus inhibits the hypertrophic response. PMID: 24526256
  26. we concluded that the IRF-8 KO cells performed pure uncorrelated random walks, while WT splenocytes were able to make singular drifted random walks that collapsed on a straight ballistic motion for the system as a whole PMID: 25322144
  27. IRF5 expression in microglia is regulated by IRF8. IRF5 directly upregulates P2rX4 expression on microglia in peripheral nerve injury, and may play a role in neuropathic pain. PMID: 24818655
  28. Data indicte that interferon regulatory factor 8 (IRF8) expression becomes dependent on transcription factor Batf3. PMID: 26054719
  29. These data highlight a critical role for IRF8 in inflammatory monocyte differentiation and migration during WNV infection. PMID: 25277331
  30. IRF8 is a major autophagy regulator in macrophages, essential for macrophage maturation, survival and innate immune responses PMID: 25775030
  31. plays a key role in the cross-talk between melanoma and immune cells delimiting tumor spread PMID: 24597645
  32. Irf8-knockout microglia exhibited a differential expression pattern of nucleotide-degrading enzymes compared to their wild-type counterparts. PMID: 24798612
  33. Basal IRF8-PU.1 binding maintained the expression of a broad panel of genes essential for macrophage functions (such as microbial recognition and response to purines) and contributed to basal expression of many LPS-inducible genes PMID: 25637355
  34. we demonstrate that interferon regulatory factor-8 regulates basophil and mast cell development PMID: 25398936
  35. The transcription factors IRF8 and PU.1 negatively regulate plasma cell differentiation. PMID: 25288399
  36. The overexpressed IRF8 can effectively inhibit the differentiation of RAW264.7 cells into osteoclast-like cells. PMID: 24606735
  37. we found that the transcriptional factor IRF8 plays a protective role in the cerebral ischaemic-reperfusion injury by attenuating neuronal apoptosis PMID: 24528256
  38. IRF8 enhanced alphavbeta8 integrin expression in APCs and activated TGF-beta signaling leading to T helper 17 (Th17) cell differentiation PMID: 24485804
  39. Data indicate that interferon regulatory factor 8 (IRF8) inhibited smooth muscle cells (SMCs) marker gene expression through regulating serum response factor (SRF) transactivation in a myocardin-dependent manner. PMID: 24248596
  40. Data from mutant/knockout mice suggest that Irf8 is involved in innate immunity against Plasmodium berghei cerebral malaria; neuronal gene expression up-regulated by Plasmodium berghei infection favors proteins with IRF8 binding sites. PMID: 23853600
  41. IRF-8 is an essential factor for the maintenance of proper immune cell recruitment in granulomas. PMID: 23717393
  42. IRF8-deficient mice produced anti-dsDNA Abs. In a double-transgenic model, B cell anergy was breached in IRF8-deficient mice. Anergic B cells in the IRF8-deficient background were able to mature further & regain responses to Ag stimulation. PMID: 24218455
  43. Irf8 expression in DC9 cells led to an increase in Id2 & Batf3 transcript levels. Without it, Id2 & Batf3 expression was insufficient for directing classical CD8alpha(+) DC development. PMID: 24227775
  44. IRF8-rescued BCR-ABL-expressing dendritic cells were capable of inducing CTLs more efficiently than control dendritic cells. IRF8 is an attractive target in next-generation therapies for chronic myelogenous leukemia. PMID: 24242069
  45. These results suggest a central role for IFN regulatory factor 8-expressing CD8(+) DCs in governing the TLR11- and TLR12-mediated host defense against Toxoplasma gondii. PMID: 24078692
  46. Irf8 Expression Is Required for Transcriptional Identity of Early DC Progenitors. PMID: 23623495
  47. Irf8-deficient mice generate myeloid populations highly homologous to tumor-induced myeloid-derived suppressor cells. PMID: 24091328
  48. MiR-22 binds directly to the 3'UTR of the mouse Irf8 mRNA. PMID: 23251709
  49. Data indicate that Bcr-abl increases PTPN13 promoter activity in an Icsbp-dependent manner. PMID: 22891763
  50. these results underscore a key role of IRF-8 in the cross talk between melanoma and immune cells, thus revealing its critical function within the tumor microenvironment in regulating melanoma progression and invasiveness. PMID: 23308054
  51. this study demonstrated the essential contribution of IRF8-mediated transcription to a broad range of microglial phenotype PMID: 23020843
  52. IFN regulatory factor 8 is a key constitutive determinant of the morphological and molecular properties of microglia in the CNS. PMID: 23166780
  53. results demonstrate pDCs and the production of type I IFNs by these cells are critical contributors to the pathogenesis of lupus-like autoimmunity in these models. IRF8 and SLC15A4 may provide important targets for therapeutic intervention in human lupus PMID: 23382217
  54. IRF8 has a role in the central nervous system as a key transcription regulator of microglia involved in converting to a reactive state after peripheral nerve injury in vivo. PMID: 22832225
  55. Interferon regulatory factor-8 is important for histone deacetylase inhibitor-mediated antitumor activity. PMID: 23028998
  56. Compensation among BATF factors is based on the shared capacity of their leucine zipper domains to interact with non-AP1 factors such as IRF4 and IRF8 to mediate cooperative gene activation. PMID: 22992524
  57. Interferon regulatory factor 8 integrates T-cell receptor and cytokine-signaling pathways and drives effector differentiation of CD8 T cells. PMID: 22783014
  58. The results defined a signaling network in which signaling via Notch-RBP-J and TLRs is integrated at the level of IRF8 synthesis. A mechanism was identified by which heterologous signaling pathways can regulate TLR-induced polarization of macrophages. PMID: 22610140
  59. depletion of polymorphonuclear neutrophilic leukocytes in low-density lipoprotein receptor or apolipoprotein E-deficient mice with IRF8(-/-) or IRF8(-/-) apolipoprotein E-deficient bone marrow abrogated increased lesion formation PMID: 22556330
  60. IRF-8 represses a neutrophil module of development and promotes convergent DC development from multiple lymphoid and myeloid progenitors autonomously of cellular context. PMID: 22238324
  61. Data showed that IRF8 target genes contributes to multiple aspects of the biology of mature B cells including critical components of the molecular crosstalk among GC B cells, T follicular helper cells, and follicular dendritic cells. PMID: 22096565
  62. IRF4 has activities similar to IRF8 in regulating myeloid cell development PMID: 22003407
  63. IRF8 directly binds to the Bax promoter to regulate Bax transcription in primary myeloid cells in vivo but not in vitro. PMID: 21949018
  64. IRF-8 plays an important role in tumour-induced development and/or accumulation of CD11b(+)Gr-1(+) cells PMID: 20196788
  65. IRF8 gene expression was higher in splenocytes of NOD mice PMID: 21647406
  66. IRF8 is a key regulator of early response pathways in myeloid cells, including phagosome maturation, antigen processing, and antigen presentation. PMID: 21731497
  67. Liver X receptor alpha binds the interferon regulatory factor 8 (IRF8) locus; its activation increases IRF8 mRNA and protein levels in macrophages PMID: 21757649
  68. IRF8 deficiency enhances TH17-cell differentiation. PMID: 21587231
  69. Findings determine the mechanism of IRF8 downregulation in CML cells. PMID: 21487040
  70. Transcription factor IFN regulatory factor (IRF)8 is critical for CstC expression in primary dendritic cells (DC). Inflammation causes downregulation of IRF-8 expression in DC. PMID: 21300820
  71. Data establish 12/15-LOX-mediated redox signaling as a novel regulator of myelopoiesis and Irf8. PMID: 20647030
  72. mice deficient in both IRF-4 and IRF-8 develop from a very early age a more aggressive chronic myelogenous leukemia-like disease than mice deficient in IRF-8 alone, correlating with a greater expansion of granulocyte-monocyte progenitors PMID: 20585039
  73. IL-27 p28 gene transcription is activated by interferon regulatory factor 8 in cooperation with interferon regulatory factor 1 PMID: 20435892
  74. IRF8-deficient mice show differential requirements for IRF8 among distinct subsets of B cells, DC, and macrophages PMID: 18663414
  75. Resutls show that DNA cross-link repair is impaired in ICSBP-deficient myeloid cells in a FancF-dependent manner. PMID: 19801548
  76. Data demonstrate that transcription of the Tlr11 gene is regulated through epithelium-specific transcription factors and IRF-8. PMID: 19801549
  77. this review discusses the regulatory roles of ICSBP/IRF-8 in the development of myeloid cells PMID: 11846985
  78. Susceptibility of Icsbp Knockout Mice to to brucellosis PMID: 11859135
  79. ICSBP plays a critical role in myeloid cell development by controlling lineage selection and is indispensable for IFN-gamma-dependent modulation of progenitor cell maturation. PMID: 12133947
  80. IRF-8 binding to TEL for recruitment of HDAC3 is regulated by gamma-interferon PMID: 12370291
  81. ICSBP as a factor critical for both early differentiation and final maturation of dendritic cells and expression of CD8alpha and IL-12 p40 as well as major histocompatability complex class II and other costimulatory molecules PMID: 12393459
  82. Essential role for ICSBP in the in vivo development of murine CD8alpha + dendritic cells. PMID: 12393690
  83. IRF8 has a role in regulating iNOS gene expression in murine macrophages PMID: 12429737
  84. ICSBP is essential for the development of mouse type I interferon-producing cells and for the generation and activation of CD8alpha(+) dendritic cells. PMID: 12461077
  85. ICSBP is indispensable for the development of immature plasmacytoid dendritic cells (pDCs) and for Toll-like receptor-medidated maturation of both myeloid DCs and pDCs. PMID: 12538667
  86. dysregulation by tumor-derived cytokines PMID: 12626771
  87. a composite NFAT/ICSBP binding site at -68 to -54 is identified that is functionally important for IL-12 p40 promoter activation PMID: 12876285
  88. ICSBP inhibits growth of Bcr/Abl-transformed myeloid progenitor cells by activating several genes that interfere with the c-Myc pathway. PMID: 12933588
  89. ICSBP is critically required for the development and trafficking of skin DCs, thus playing a critical role in the dendritic cell-mediated initiation of T-cell immunity. PMID: 14615368
  90. introduction of the ICSBP into ICSBP-null Tot2 cells led to a significant increase in p15(Ink4b) RNA expression and both ICSBP and PU.1 must bind to DNA to form a stable complex PMID: 14976051
  91. ICSBP1 activates transcription of the gene encoding neurofibromin 1 PMID: 15371411
  92. interleukin-12 p35 gene transcription is activated by interferon regulatory factor-1 and interferon consensus sequence-binding protein PMID: 15489234
  93. IRF-8 and IRF-4 are differentially expressed in dendritic cell (DC) subsets and are required for their development, each IRF possessing a distinct activity to stimulate subset-specific gene expression leading to generation of functionally divergent DCs. PMID: 15728463
  94. Inactivation of Icsbp1 predisposes to myeloproliferation and immunodeficiency. PMID: 15781580
  95. proteasomal degradation of IRF-8 mediated by the ubiquitin E3 ligase Cbl down-regulates IL-12 expression PMID: 15837792
  96. IRF-8 stimulates transcription of target genes through a novel cis element to specify macrophage differentiation PMID: 15947094
  97. throughout the developmental program of DCs, ICSBP differentially controls Ag uptake and MHC class II (MHC-II) presentation affecting both functions only in differentiated peripheral DCs. PMID: 16569763
  98. IRF-8 regulates RANTES gene transcription in cooperation with interferon regulatory factor-1, NF-kappaB, and PU.1 PMID: 16707500
  99. ICSBP might be involved in an early modulation of an immune response to exogenous murine leukemia virus that might also play a role in proliferation of the mature B-cell lymphomas. PMID: 16780917
  100. The mRNA expression of the IRF family member IFN consensus-binding protein [(ICSBP)/IRF8] was coregulated with Tlr9 in macrophages, and constitutive and IFN-gamma-inducible Tlr9 mRNA expression was reduced in ICSBP-deficient BMM. PMID: 17360957

Show More

Hide All

Subcellular Location Nucleus, Cytoplasm
Protein Families IRF family
Tissue Specificity Predominantly in lymphoid tissues.
Database Links

KEGG: mmu:15900

STRING: 10090.ENSMUSP00000040245

UniGene: Mm.334861

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1